Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4RBL0

Protein Details
Accession A0A1E4RBL0    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MNFERLEKNKNKKSNRKKDGRKKKSQPFRSVRVSHydrophilic
NLS Segment(s)
PositionSequence
8-26KNKNKKSNRKKDGRKKKSQ
Subcellular Location(s) nucl 13.5, mito_nucl 11.833, cyto_nucl 9.666, mito 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MNFERLEKNKNKKSNRKKDGRKKKSQPFRSVRVSADGLLTWGKHPCTRVYSGRSLKVVSIRMLFTNWYAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.91
4 0.93
5 0.95
6 0.95
7 0.95
8 0.95
9 0.94
10 0.93
11 0.93
12 0.92
13 0.91
14 0.87
15 0.83
16 0.8
17 0.72
18 0.62
19 0.55
20 0.47
21 0.36
22 0.29
23 0.22
24 0.15
25 0.12
26 0.11
27 0.08
28 0.09
29 0.1
30 0.11
31 0.13
32 0.15
33 0.19
34 0.24
35 0.3
36 0.33
37 0.42
38 0.46
39 0.49
40 0.48
41 0.44
42 0.42
43 0.41
44 0.38
45 0.32
46 0.29
47 0.26
48 0.25
49 0.25
50 0.24