Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H2B0J8

Protein Details
Accession H2B0J8    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-29DRILSKFSSWKKYKNRGNRGGPVRRASHydrophilic
NLS Segment(s)
PositionSequence
16-26KNRGNRGGPVR
Subcellular Location(s) nucl 16, mito_nucl 13.166, cyto_nucl 10.666, mito 8
Family & Domain DBs
KEGG kaf:KAFR_0J00800  -  
Amino Acid Sequences MSDRILSKFSSWKKYKNRGNRGGPVRRASIRRVDYTSVQELRSHKFIFHRGFTSRRDSLKRARKFSNKNELQSIMRYINLSQMNIKEIVTAPLMTIFQPLHNNSVVVPRRTVRTSVYKRRSIRRAATLPASLRSNHSRYSSNKRIKLLRLWKEYLLLVILQRVHLRINLLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.79
3 0.81
4 0.85
5 0.85
6 0.88
7 0.88
8 0.88
9 0.87
10 0.84
11 0.78
12 0.73
13 0.69
14 0.63
15 0.57
16 0.57
17 0.52
18 0.5
19 0.49
20 0.47
21 0.44
22 0.46
23 0.48
24 0.41
25 0.37
26 0.36
27 0.35
28 0.36
29 0.37
30 0.32
31 0.27
32 0.29
33 0.36
34 0.37
35 0.37
36 0.37
37 0.36
38 0.4
39 0.41
40 0.44
41 0.41
42 0.42
43 0.44
44 0.45
45 0.51
46 0.56
47 0.61
48 0.6
49 0.63
50 0.67
51 0.71
52 0.76
53 0.77
54 0.73
55 0.67
56 0.65
57 0.59
58 0.5
59 0.43
60 0.37
61 0.26
62 0.21
63 0.18
64 0.15
65 0.18
66 0.17
67 0.16
68 0.15
69 0.15
70 0.15
71 0.15
72 0.15
73 0.1
74 0.09
75 0.1
76 0.09
77 0.08
78 0.07
79 0.07
80 0.07
81 0.07
82 0.08
83 0.07
84 0.08
85 0.11
86 0.12
87 0.13
88 0.13
89 0.13
90 0.13
91 0.21
92 0.24
93 0.22
94 0.23
95 0.22
96 0.25
97 0.27
98 0.28
99 0.23
100 0.3
101 0.39
102 0.48
103 0.55
104 0.6
105 0.64
106 0.72
107 0.75
108 0.72
109 0.69
110 0.68
111 0.64
112 0.6
113 0.59
114 0.54
115 0.49
116 0.44
117 0.39
118 0.3
119 0.31
120 0.33
121 0.32
122 0.31
123 0.32
124 0.35
125 0.39
126 0.49
127 0.54
128 0.58
129 0.61
130 0.63
131 0.67
132 0.66
133 0.71
134 0.71
135 0.7
136 0.68
137 0.66
138 0.61
139 0.57
140 0.52
141 0.43
142 0.33
143 0.25
144 0.17
145 0.17
146 0.16
147 0.16
148 0.17
149 0.17
150 0.17
151 0.17