Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RG15

Protein Details
Accession A0A1E4RG15   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
173-196LDLPVKRPHPPAKPSRPTKLKLKKBasic
NLS Segment(s)
PositionSequence
178-196KRPHPPAKPSRPTKLKLKK
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR033194  MFAP1  
IPR009730  MFAP1_C  
Pfam View protein in Pfam  
PF06991  MFAP1  
Amino Acid Sequences MAQVTRGPVKHSLVDGGEQDPSGSGRSGSSESESDSESDSDSDSDSDSDSDSDSDRPMVKPVFLSKSKRQPGQSPQEDTDRLKRITLSKAEHSLQADEKEVKEDQFDGIQDTDDVNPEAEYLEWMQREYQRYQRDRSTLKLEEDEKDALVRRRLNLEVPSVDEPSADGSTFQLDLPVKRPHPPAKPSRPTKLKLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.24
4 0.21
5 0.18
6 0.17
7 0.14
8 0.13
9 0.12
10 0.1
11 0.09
12 0.08
13 0.12
14 0.13
15 0.14
16 0.16
17 0.15
18 0.17
19 0.18
20 0.18
21 0.16
22 0.16
23 0.15
24 0.13
25 0.13
26 0.11
27 0.1
28 0.1
29 0.1
30 0.09
31 0.09
32 0.09
33 0.08
34 0.08
35 0.08
36 0.08
37 0.09
38 0.09
39 0.1
40 0.1
41 0.12
42 0.13
43 0.13
44 0.16
45 0.16
46 0.15
47 0.17
48 0.21
49 0.25
50 0.29
51 0.36
52 0.4
53 0.49
54 0.55
55 0.58
56 0.57
57 0.57
58 0.61
59 0.65
60 0.64
61 0.58
62 0.54
63 0.54
64 0.53
65 0.48
66 0.46
67 0.4
68 0.34
69 0.3
70 0.3
71 0.28
72 0.31
73 0.34
74 0.31
75 0.28
76 0.32
77 0.32
78 0.32
79 0.3
80 0.26
81 0.22
82 0.19
83 0.18
84 0.15
85 0.14
86 0.14
87 0.14
88 0.12
89 0.11
90 0.1
91 0.09
92 0.09
93 0.09
94 0.08
95 0.08
96 0.08
97 0.08
98 0.08
99 0.08
100 0.07
101 0.08
102 0.06
103 0.06
104 0.06
105 0.06
106 0.05
107 0.06
108 0.06
109 0.08
110 0.08
111 0.09
112 0.11
113 0.15
114 0.19
115 0.21
116 0.28
117 0.35
118 0.39
119 0.43
120 0.47
121 0.5
122 0.49
123 0.51
124 0.51
125 0.46
126 0.45
127 0.45
128 0.42
129 0.37
130 0.37
131 0.33
132 0.25
133 0.23
134 0.25
135 0.23
136 0.27
137 0.28
138 0.26
139 0.3
140 0.31
141 0.34
142 0.32
143 0.33
144 0.29
145 0.3
146 0.31
147 0.28
148 0.26
149 0.22
150 0.19
151 0.18
152 0.17
153 0.13
154 0.11
155 0.1
156 0.11
157 0.12
158 0.12
159 0.13
160 0.14
161 0.16
162 0.21
163 0.29
164 0.29
165 0.35
166 0.43
167 0.47
168 0.54
169 0.62
170 0.67
171 0.7
172 0.79
173 0.82
174 0.85
175 0.85
176 0.82