Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RNA1

Protein Details
Accession A0A1E4RNA1   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
81-114MDSVLRKRRLKMKKHKLRKRRRAQRSLKKRLGKIBasic
NLS Segment(s)
PositionSequence
86-114RKRRLKMKKHKLRKRRRAQRSLKKRLGKI
Subcellular Location(s) mito 19, nucl 6, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MFRSVFSRGAAAFGSRMYASIARPVLSKPTFFNLNQSPVSKSFINQIQFPQSSIASNLNAWETPGLEDTDMSLENDNTMYMDSVLRKRRLKMKKHKLRKRRRAQRSLKKRLGKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.11
4 0.11
5 0.13
6 0.12
7 0.18
8 0.19
9 0.17
10 0.18
11 0.18
12 0.24
13 0.24
14 0.25
15 0.21
16 0.24
17 0.28
18 0.27
19 0.33
20 0.29
21 0.32
22 0.33
23 0.33
24 0.31
25 0.28
26 0.32
27 0.25
28 0.22
29 0.22
30 0.25
31 0.25
32 0.23
33 0.23
34 0.25
35 0.25
36 0.25
37 0.22
38 0.17
39 0.15
40 0.16
41 0.15
42 0.1
43 0.1
44 0.1
45 0.09
46 0.08
47 0.08
48 0.07
49 0.06
50 0.06
51 0.07
52 0.07
53 0.06
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.06
65 0.06
66 0.05
67 0.05
68 0.07
69 0.1
70 0.17
71 0.24
72 0.31
73 0.35
74 0.4
75 0.49
76 0.57
77 0.65
78 0.7
79 0.74
80 0.78
81 0.86
82 0.92
83 0.93
84 0.95
85 0.95
86 0.95
87 0.95
88 0.95
89 0.95
90 0.96
91 0.96
92 0.96
93 0.96
94 0.94