Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RK95

Protein Details
Accession A0A1E4RK95    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
110-134DETLMKPKELKRRQKIQEFYKKRLLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 12.333, mito_nucl 12.333, mito 2.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021475  DUF3128  
Pfam View protein in Pfam  
PF11326  DUF3128  
Amino Acid Sequences MAKLVRHLTREQEDLQELWKLFKDSPEDIQTRRKQVTSIIQENNSSSFPSEISVLTSIDELTGCFGLGYQLKNYYRYGEYSDCKRQREKFWFAIKNGSIMEGSDTYSINDETLMKPKELKRRQKIQEFYKKRLLEDKARGSSEDIWSERKEPLVNFLNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.31
4 0.26
5 0.24
6 0.24
7 0.22
8 0.2
9 0.24
10 0.27
11 0.25
12 0.31
13 0.36
14 0.37
15 0.38
16 0.47
17 0.49
18 0.51
19 0.51
20 0.45
21 0.39
22 0.42
23 0.48
24 0.47
25 0.49
26 0.47
27 0.46
28 0.46
29 0.46
30 0.42
31 0.32
32 0.24
33 0.16
34 0.12
35 0.1
36 0.1
37 0.1
38 0.08
39 0.09
40 0.1
41 0.09
42 0.09
43 0.09
44 0.08
45 0.07
46 0.07
47 0.05
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.06
54 0.07
55 0.08
56 0.08
57 0.14
58 0.15
59 0.17
60 0.17
61 0.18
62 0.18
63 0.18
64 0.21
65 0.2
66 0.22
67 0.26
68 0.36
69 0.37
70 0.39
71 0.44
72 0.45
73 0.49
74 0.55
75 0.55
76 0.54
77 0.59
78 0.61
79 0.57
80 0.59
81 0.5
82 0.44
83 0.37
84 0.3
85 0.2
86 0.15
87 0.16
88 0.09
89 0.1
90 0.09
91 0.09
92 0.08
93 0.1
94 0.1
95 0.08
96 0.08
97 0.08
98 0.09
99 0.17
100 0.18
101 0.17
102 0.22
103 0.28
104 0.39
105 0.47
106 0.57
107 0.59
108 0.68
109 0.77
110 0.82
111 0.85
112 0.85
113 0.87
114 0.83
115 0.8
116 0.79
117 0.72
118 0.64
119 0.64
120 0.59
121 0.58
122 0.6
123 0.62
124 0.59
125 0.59
126 0.57
127 0.53
128 0.51
129 0.45
130 0.42
131 0.35
132 0.33
133 0.34
134 0.35
135 0.33
136 0.32
137 0.31
138 0.25
139 0.31