Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4RF15

Protein Details
Accession A0A1E4RF15    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
52-76FKKVDFMRWRKRQIGKQNASRIKNNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12, nucl 11.5, mito 11.5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MNESLGKSTCKAGTILNLKIRKAGDEPVALEDSEYPEWLWDSLNKEKMDEDFKKVDFMRWRKRQIGKQNASRIKNNNFLSQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.38
4 0.4
5 0.39
6 0.42
7 0.41
8 0.35
9 0.31
10 0.29
11 0.24
12 0.23
13 0.24
14 0.23
15 0.23
16 0.2
17 0.18
18 0.15
19 0.14
20 0.12
21 0.11
22 0.08
23 0.08
24 0.08
25 0.08
26 0.08
27 0.07
28 0.12
29 0.16
30 0.22
31 0.22
32 0.22
33 0.22
34 0.24
35 0.3
36 0.27
37 0.28
38 0.26
39 0.26
40 0.31
41 0.3
42 0.34
43 0.35
44 0.43
45 0.48
46 0.54
47 0.61
48 0.65
49 0.73
50 0.77
51 0.79
52 0.81
53 0.79
54 0.8
55 0.84
56 0.84
57 0.81
58 0.78
59 0.76
60 0.71
61 0.71
62 0.65