Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RD37

Protein Details
Accession A0A1E4RD37   
Localization Confidence High
Confidence Score 19.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MGNLIKEHVSPKKRRKLRRTKDEIEEDIIHydrophilic
42-63ENDIPPRKMKSRRIIKREEEEFBasic
NLS Segment(s)
PositionSequence
11-20PKKRRKLRRT
51-51K
53-53R
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MGNLIKEHVSPKKRRKLRRTKDEIEEDIIRYQELLKHDKELENDIPPRKMKSRRIIKREEEEFGAFDNAIPTNRRNRSTGDKCKETRPSSKSNEKMITDLIETMTREVLKINKPKYKFAKVPFKKPSPLKYLHQDLPPPINQEIKSFESKVLVENSYQDLIKMIKSDIENEEVDGKRYNNIDFGMKLNLLEKNLSFEKDRFEIYDNEEKSKVEKLLKPNDVYRSRGLFSEDIDVFFKHLYNPDNFRNDTTTKDQLKRSIPLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.88
3 0.9
4 0.92
5 0.93
6 0.93
7 0.9
8 0.91
9 0.88
10 0.81
11 0.75
12 0.67
13 0.58
14 0.5
15 0.42
16 0.31
17 0.23
18 0.21
19 0.18
20 0.2
21 0.23
22 0.22
23 0.26
24 0.3
25 0.33
26 0.34
27 0.36
28 0.35
29 0.37
30 0.42
31 0.41
32 0.43
33 0.42
34 0.45
35 0.47
36 0.52
37 0.55
38 0.59
39 0.66
40 0.71
41 0.78
42 0.82
43 0.82
44 0.83
45 0.78
46 0.7
47 0.63
48 0.53
49 0.45
50 0.37
51 0.3
52 0.2
53 0.16
54 0.14
55 0.11
56 0.11
57 0.13
58 0.14
59 0.23
60 0.28
61 0.3
62 0.31
63 0.35
64 0.44
65 0.53
66 0.61
67 0.59
68 0.62
69 0.62
70 0.68
71 0.72
72 0.67
73 0.65
74 0.6
75 0.61
76 0.6
77 0.68
78 0.66
79 0.64
80 0.64
81 0.55
82 0.51
83 0.43
84 0.37
85 0.27
86 0.23
87 0.16
88 0.12
89 0.11
90 0.1
91 0.11
92 0.09
93 0.09
94 0.09
95 0.13
96 0.18
97 0.25
98 0.31
99 0.36
100 0.38
101 0.46
102 0.52
103 0.55
104 0.55
105 0.56
106 0.61
107 0.6
108 0.68
109 0.68
110 0.65
111 0.65
112 0.63
113 0.61
114 0.57
115 0.57
116 0.5
117 0.49
118 0.5
119 0.47
120 0.44
121 0.4
122 0.35
123 0.34
124 0.32
125 0.28
126 0.23
127 0.23
128 0.21
129 0.21
130 0.23
131 0.22
132 0.23
133 0.21
134 0.21
135 0.19
136 0.19
137 0.19
138 0.17
139 0.15
140 0.13
141 0.13
142 0.15
143 0.14
144 0.14
145 0.12
146 0.1
147 0.1
148 0.1
149 0.1
150 0.08
151 0.1
152 0.11
153 0.14
154 0.14
155 0.17
156 0.16
157 0.16
158 0.22
159 0.19
160 0.2
161 0.19
162 0.18
163 0.18
164 0.19
165 0.19
166 0.15
167 0.16
168 0.17
169 0.16
170 0.17
171 0.16
172 0.15
173 0.15
174 0.15
175 0.16
176 0.15
177 0.15
178 0.13
179 0.16
180 0.18
181 0.2
182 0.2
183 0.19
184 0.23
185 0.23
186 0.24
187 0.21
188 0.22
189 0.23
190 0.27
191 0.35
192 0.32
193 0.34
194 0.34
195 0.32
196 0.31
197 0.33
198 0.31
199 0.29
200 0.33
201 0.39
202 0.48
203 0.54
204 0.56
205 0.57
206 0.62
207 0.59
208 0.58
209 0.55
210 0.49
211 0.44
212 0.41
213 0.4
214 0.31
215 0.28
216 0.31
217 0.26
218 0.23
219 0.24
220 0.23
221 0.2
222 0.19
223 0.18
224 0.13
225 0.17
226 0.2
227 0.24
228 0.3
229 0.37
230 0.43
231 0.44
232 0.45
233 0.46
234 0.43
235 0.44
236 0.44
237 0.46
238 0.48
239 0.53
240 0.55
241 0.57
242 0.62