Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4RGJ6

Protein Details
Accession A0A1E4RGJ6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
249-273ATSAPIASKKNKKDNKEKDSQMNSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013241  RNase_P_Pop3  
Gene Ontology GO:0006364  P:rRNA processing  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF08228  RNase_P_pop3  
Amino Acid Sequences MSTEKSDNPKEKGGPSKGSLKEAAQKRRQVFKPILDNPYTQSNLWPEVRPQDATNIEQLLCLHLSPLGRFNEALKESKSKSIDKDRGLLPDQPSIASEMTIGFNSTVKALEEQASVHRMKLKNTKKHKESDNTTKKAYIKYVFVAKSDIRPPLLIQSFPTLAFTASKSAEDRVKLVELPKGAMNRLSDSLKIPSTSIIGMTKNVKEAGSLYNMIESNITDVKVPWLESLFDNPENLRPLFHKPALKVLATSAPIASKKNKKDNKEKDSQMNSSSKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.56
3 0.61
4 0.57
5 0.57
6 0.53
7 0.46
8 0.49
9 0.52
10 0.58
11 0.56
12 0.61
13 0.63
14 0.71
15 0.72
16 0.71
17 0.69
18 0.67
19 0.7
20 0.69
21 0.69
22 0.61
23 0.58
24 0.52
25 0.52
26 0.46
27 0.35
28 0.32
29 0.28
30 0.31
31 0.32
32 0.31
33 0.27
34 0.3
35 0.33
36 0.31
37 0.29
38 0.3
39 0.3
40 0.3
41 0.3
42 0.27
43 0.24
44 0.23
45 0.22
46 0.17
47 0.15
48 0.13
49 0.1
50 0.1
51 0.11
52 0.11
53 0.16
54 0.16
55 0.17
56 0.17
57 0.18
58 0.23
59 0.25
60 0.27
61 0.24
62 0.28
63 0.29
64 0.35
65 0.37
66 0.33
67 0.38
68 0.45
69 0.5
70 0.47
71 0.5
72 0.46
73 0.47
74 0.47
75 0.45
76 0.36
77 0.33
78 0.31
79 0.26
80 0.24
81 0.21
82 0.18
83 0.13
84 0.11
85 0.08
86 0.09
87 0.08
88 0.08
89 0.06
90 0.07
91 0.07
92 0.07
93 0.07
94 0.06
95 0.07
96 0.08
97 0.09
98 0.09
99 0.09
100 0.11
101 0.14
102 0.14
103 0.13
104 0.19
105 0.18
106 0.23
107 0.32
108 0.4
109 0.46
110 0.57
111 0.66
112 0.64
113 0.7
114 0.73
115 0.72
116 0.7
117 0.72
118 0.71
119 0.65
120 0.61
121 0.58
122 0.52
123 0.46
124 0.42
125 0.33
126 0.24
127 0.23
128 0.28
129 0.25
130 0.23
131 0.24
132 0.21
133 0.22
134 0.23
135 0.23
136 0.17
137 0.17
138 0.16
139 0.2
140 0.21
141 0.17
142 0.15
143 0.17
144 0.17
145 0.17
146 0.17
147 0.11
148 0.1
149 0.11
150 0.1
151 0.1
152 0.1
153 0.11
154 0.11
155 0.13
156 0.15
157 0.15
158 0.16
159 0.15
160 0.15
161 0.16
162 0.16
163 0.17
164 0.14
165 0.15
166 0.17
167 0.16
168 0.15
169 0.17
170 0.17
171 0.16
172 0.19
173 0.19
174 0.17
175 0.18
176 0.2
177 0.19
178 0.18
179 0.16
180 0.14
181 0.14
182 0.13
183 0.13
184 0.12
185 0.11
186 0.14
187 0.17
188 0.17
189 0.18
190 0.19
191 0.17
192 0.15
193 0.16
194 0.16
195 0.16
196 0.17
197 0.15
198 0.17
199 0.17
200 0.17
201 0.16
202 0.13
203 0.13
204 0.13
205 0.13
206 0.1
207 0.1
208 0.14
209 0.15
210 0.15
211 0.13
212 0.13
213 0.15
214 0.15
215 0.2
216 0.22
217 0.21
218 0.22
219 0.21
220 0.24
221 0.27
222 0.26
223 0.23
224 0.2
225 0.27
226 0.34
227 0.38
228 0.4
229 0.37
230 0.46
231 0.48
232 0.46
233 0.39
234 0.34
235 0.34
236 0.3
237 0.3
238 0.22
239 0.22
240 0.23
241 0.26
242 0.33
243 0.37
244 0.45
245 0.55
246 0.62
247 0.68
248 0.77
249 0.84
250 0.85
251 0.86
252 0.84
253 0.84
254 0.84
255 0.79
256 0.75
257 0.71