Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RQ03

Protein Details
Accession A0A1E4RQ03    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
85-113DKKVKGYRKSLHRVPKWTKKSFRENPKYFBasic
NLS Segment(s)
PositionSequence
92-103RKSLHRVPKWTK
Subcellular Location(s) mito 20.5, mito_nucl 12.833, nucl 4, cyto_nucl 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFKATLIKSGGYLWKFAPRMSGVQKYRLRQRMKQVDSNIEVLYKSLKPEGTALTGHKKIDYLKFEFPKESQMTPHDKYTTFDKKVKGYRKSLHRVPKWTKKSFRENPKYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.21
4 0.27
5 0.28
6 0.27
7 0.28
8 0.24
9 0.29
10 0.33
11 0.41
12 0.36
13 0.45
14 0.5
15 0.52
16 0.59
17 0.62
18 0.62
19 0.59
20 0.67
21 0.69
22 0.69
23 0.7
24 0.65
25 0.63
26 0.59
27 0.54
28 0.44
29 0.33
30 0.27
31 0.2
32 0.19
33 0.13
34 0.11
35 0.11
36 0.11
37 0.11
38 0.12
39 0.13
40 0.12
41 0.13
42 0.14
43 0.18
44 0.2
45 0.19
46 0.18
47 0.18
48 0.18
49 0.23
50 0.25
51 0.24
52 0.3
53 0.33
54 0.34
55 0.35
56 0.33
57 0.35
58 0.33
59 0.29
60 0.25
61 0.27
62 0.32
63 0.33
64 0.37
65 0.32
66 0.3
67 0.31
68 0.37
69 0.42
70 0.4
71 0.43
72 0.42
73 0.48
74 0.56
75 0.64
76 0.62
77 0.62
78 0.65
79 0.71
80 0.76
81 0.77
82 0.79
83 0.77
84 0.8
85 0.81
86 0.84
87 0.83
88 0.84
89 0.85
90 0.83
91 0.87
92 0.86
93 0.88