Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RJC4

Protein Details
Accession A0A1E4RJC4   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
297-316NESRKKSQVKLLQQFNNLKKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR001578  Peptidase_C12_UCH  
IPR036959  Peptidase_C12_UCH_sf  
IPR017390  Ubiquitinyl_hydrolase_UCH37  
Gene Ontology GO:0004843  F:cysteine-type deubiquitinase activity  
GO:0016579  P:protein deubiquitination  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF01088  Peptidase_C12  
Amino Acid Sequences MSDSGWNTIDSDAGVFTELVEKLGIQDVQFDDLYSIDSDSLNSMSPLYGVVFLFKYGNVDRSYAKDGNKPLDGEYDTEYQSKGIFFANQIIQNACATQAVLNILLNVKSLELGKDIGGFKSFVEGLDGEIIAEAISNSEIIRTVHNSFSAPNLIVDEDKPAPPPDYDDKNDGLFHFIGYVNIDNQIYELDGLKKYPIKHDKLQTPQEFTEKLPEILMRRIGKYGDELRFSLLGVTNDKLKYAQSIGDDSLLSSESLKRETWHRENELRRNDNMGLLVALLKNINKGLSDEEYEKLLNESRKKSQVKLLQQFNNLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.07
4 0.11
5 0.11
6 0.11
7 0.11
8 0.11
9 0.11
10 0.15
11 0.15
12 0.11
13 0.15
14 0.15
15 0.19
16 0.19
17 0.17
18 0.14
19 0.13
20 0.15
21 0.11
22 0.11
23 0.08
24 0.08
25 0.09
26 0.1
27 0.1
28 0.09
29 0.09
30 0.09
31 0.08
32 0.08
33 0.08
34 0.07
35 0.09
36 0.08
37 0.1
38 0.1
39 0.11
40 0.11
41 0.11
42 0.14
43 0.14
44 0.18
45 0.17
46 0.19
47 0.2
48 0.24
49 0.31
50 0.31
51 0.32
52 0.33
53 0.36
54 0.39
55 0.41
56 0.37
57 0.31
58 0.32
59 0.3
60 0.26
61 0.26
62 0.24
63 0.22
64 0.22
65 0.21
66 0.16
67 0.16
68 0.14
69 0.11
70 0.09
71 0.09
72 0.09
73 0.14
74 0.17
75 0.19
76 0.2
77 0.2
78 0.19
79 0.18
80 0.18
81 0.13
82 0.09
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.08
91 0.08
92 0.08
93 0.07
94 0.06
95 0.06
96 0.07
97 0.07
98 0.07
99 0.08
100 0.07
101 0.11
102 0.12
103 0.11
104 0.12
105 0.12
106 0.1
107 0.12
108 0.12
109 0.08
110 0.08
111 0.08
112 0.08
113 0.08
114 0.08
115 0.06
116 0.06
117 0.06
118 0.04
119 0.04
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.04
127 0.05
128 0.06
129 0.09
130 0.11
131 0.11
132 0.12
133 0.12
134 0.12
135 0.13
136 0.13
137 0.11
138 0.09
139 0.08
140 0.08
141 0.08
142 0.08
143 0.1
144 0.09
145 0.1
146 0.11
147 0.11
148 0.12
149 0.11
150 0.15
151 0.18
152 0.22
153 0.23
154 0.25
155 0.26
156 0.26
157 0.26
158 0.22
159 0.2
160 0.14
161 0.12
162 0.11
163 0.1
164 0.09
165 0.09
166 0.09
167 0.07
168 0.08
169 0.08
170 0.07
171 0.07
172 0.06
173 0.06
174 0.05
175 0.06
176 0.07
177 0.08
178 0.08
179 0.1
180 0.13
181 0.14
182 0.23
183 0.3
184 0.34
185 0.41
186 0.48
187 0.55
188 0.6
189 0.69
190 0.63
191 0.6
192 0.55
193 0.52
194 0.46
195 0.38
196 0.37
197 0.29
198 0.26
199 0.22
200 0.22
201 0.21
202 0.23
203 0.29
204 0.23
205 0.23
206 0.24
207 0.24
208 0.22
209 0.25
210 0.3
211 0.27
212 0.27
213 0.27
214 0.27
215 0.27
216 0.26
217 0.22
218 0.17
219 0.15
220 0.15
221 0.15
222 0.18
223 0.18
224 0.19
225 0.18
226 0.15
227 0.16
228 0.15
229 0.17
230 0.15
231 0.17
232 0.18
233 0.19
234 0.18
235 0.15
236 0.15
237 0.12
238 0.1
239 0.09
240 0.11
241 0.11
242 0.14
243 0.14
244 0.15
245 0.22
246 0.31
247 0.38
248 0.44
249 0.49
250 0.56
251 0.65
252 0.73
253 0.76
254 0.72
255 0.65
256 0.62
257 0.56
258 0.49
259 0.4
260 0.31
261 0.21
262 0.17
263 0.17
264 0.11
265 0.11
266 0.1
267 0.1
268 0.11
269 0.12
270 0.12
271 0.11
272 0.12
273 0.16
274 0.18
275 0.22
276 0.23
277 0.23
278 0.25
279 0.24
280 0.23
281 0.21
282 0.23
283 0.27
284 0.32
285 0.38
286 0.43
287 0.53
288 0.57
289 0.59
290 0.63
291 0.65
292 0.68
293 0.72
294 0.74
295 0.71
296 0.77