Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RF17

Protein Details
Accession A0A1E4RF17   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
75-95LSQNKKQTNRLSKPKENRVNTHydrophilic
116-144EPIEKFKSNHYFKKNKQYKQSDRLKSKKKHydrophilic
NLS Segment(s)
PositionSequence
136-144SDRLKSKKK
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MFKTTWSILPTSWISAKKTEDVTAKAPIPTSTIFRDPNTKSTLYNISMNEQSVDDDDSFIDITTRKLSYAEVAALSQNKKQTNRLSKPKENRVNTNQYEVLAKNLKDDDDLDEMEEPIEKFKSNHYFKKNKQYKQSDRLKSKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.34
4 0.33
5 0.34
6 0.35
7 0.35
8 0.35
9 0.35
10 0.36
11 0.35
12 0.32
13 0.3
14 0.26
15 0.24
16 0.22
17 0.22
18 0.21
19 0.24
20 0.26
21 0.26
22 0.34
23 0.34
24 0.37
25 0.38
26 0.35
27 0.3
28 0.31
29 0.35
30 0.3
31 0.31
32 0.27
33 0.26
34 0.26
35 0.26
36 0.22
37 0.17
38 0.15
39 0.11
40 0.12
41 0.09
42 0.08
43 0.08
44 0.07
45 0.07
46 0.07
47 0.06
48 0.05
49 0.06
50 0.08
51 0.08
52 0.08
53 0.08
54 0.08
55 0.09
56 0.09
57 0.09
58 0.07
59 0.07
60 0.08
61 0.1
62 0.11
63 0.12
64 0.16
65 0.18
66 0.2
67 0.25
68 0.33
69 0.42
70 0.5
71 0.58
72 0.63
73 0.69
74 0.76
75 0.81
76 0.82
77 0.76
78 0.76
79 0.73
80 0.74
81 0.66
82 0.62
83 0.52
84 0.43
85 0.41
86 0.33
87 0.3
88 0.25
89 0.24
90 0.21
91 0.21
92 0.21
93 0.19
94 0.2
95 0.19
96 0.17
97 0.17
98 0.16
99 0.15
100 0.15
101 0.14
102 0.15
103 0.11
104 0.1
105 0.11
106 0.11
107 0.11
108 0.19
109 0.29
110 0.35
111 0.44
112 0.52
113 0.61
114 0.69
115 0.8
116 0.82
117 0.8
118 0.83
119 0.85
120 0.86
121 0.86
122 0.89
123 0.88
124 0.89