Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H2APS9

Protein Details
Accession H2APS9   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
117-150ETSITDSNKKKPNKRHTSRKKHEKKGFWSSLRNVHydrophilic
NLS Segment(s)
PositionSequence
125-142KKKPNKRHTSRKKHEKKG
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
KEGG kaf:KAFR_0B00810  -  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MDDTTQKYKVSTGRGGIGNFQKSGTRVSPKLVPQGSQTPALIQPVYSTGRGGVGNMRKNVDPKLTRIAQDVDADDIILVKTNTSHEIRRERTIEEVTDKPPTVAIGRGGAGNIVSPETSITDSNKKKPNKRHTSRKKHEKKGFWSSLRNVFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.42
4 0.44
5 0.4
6 0.35
7 0.33
8 0.29
9 0.27
10 0.31
11 0.29
12 0.3
13 0.28
14 0.31
15 0.37
16 0.38
17 0.46
18 0.42
19 0.38
20 0.35
21 0.41
22 0.39
23 0.35
24 0.32
25 0.25
26 0.25
27 0.25
28 0.21
29 0.14
30 0.12
31 0.13
32 0.15
33 0.13
34 0.12
35 0.1
36 0.12
37 0.12
38 0.12
39 0.15
40 0.19
41 0.24
42 0.26
43 0.27
44 0.26
45 0.28
46 0.3
47 0.31
48 0.27
49 0.25
50 0.3
51 0.3
52 0.3
53 0.3
54 0.3
55 0.25
56 0.24
57 0.21
58 0.16
59 0.13
60 0.12
61 0.1
62 0.08
63 0.05
64 0.05
65 0.04
66 0.03
67 0.04
68 0.05
69 0.09
70 0.11
71 0.13
72 0.18
73 0.26
74 0.29
75 0.34
76 0.35
77 0.32
78 0.34
79 0.34
80 0.3
81 0.27
82 0.26
83 0.23
84 0.25
85 0.24
86 0.2
87 0.18
88 0.18
89 0.14
90 0.13
91 0.12
92 0.1
93 0.11
94 0.11
95 0.1
96 0.1
97 0.08
98 0.07
99 0.06
100 0.06
101 0.05
102 0.05
103 0.05
104 0.07
105 0.09
106 0.1
107 0.13
108 0.22
109 0.27
110 0.36
111 0.43
112 0.51
113 0.59
114 0.68
115 0.76
116 0.78
117 0.83
118 0.87
119 0.9
120 0.93
121 0.95
122 0.96
123 0.95
124 0.95
125 0.95
126 0.93
127 0.91
128 0.91
129 0.9
130 0.85
131 0.83
132 0.79