Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RH39

Protein Details
Accession A0A1E4RH39    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
42-69GRVSIKCCHRARPRRINRKQARLTENSKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, mito 3
Family & Domain DBs
Amino Acid Sequences MVECITPYKRENEYANNLLSPFAQIHYRDMNGATETPSNNLGRVSIKCCHRARPRRINRKQARLTENSKMY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.4
4 0.37
5 0.33
6 0.28
7 0.21
8 0.13
9 0.1
10 0.12
11 0.12
12 0.15
13 0.16
14 0.17
15 0.16
16 0.16
17 0.16
18 0.14
19 0.13
20 0.12
21 0.11
22 0.11
23 0.11
24 0.13
25 0.12
26 0.12
27 0.11
28 0.11
29 0.12
30 0.14
31 0.17
32 0.2
33 0.24
34 0.32
35 0.34
36 0.43
37 0.51
38 0.59
39 0.66
40 0.72
41 0.8
42 0.82
43 0.91
44 0.92
45 0.92
46 0.92
47 0.91
48 0.89
49 0.86
50 0.83
51 0.8