Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RC42

Protein Details
Accession A0A1E4RC42   
Localization Confidence High
Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
18-43STITSLKKQATKKTRKNVNNKCLDLQHydrophilic
90-115EKTEQAKEAKPKRNRAKEKLAKRKAEBasic
NLS Segment(s)
PositionSequence
96-113KEAKPKRNRAKEKLAKRK
Subcellular Location(s) nucl 23, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003323  OTU_dom  
IPR038765  Papain-like_cys_pep_sf  
Pfam View protein in Pfam  
PF02338  OTU  
PROSITE View protein in PROSITE  
PS50802  OTU  
CDD cd22762  OTU_fungi_OTU2-like  
Amino Acid Sequences MSDTIEARHRKEQKDLQSTITSLKKQATKKTRKNVNNKCLDLQRDLDEKHKKELNELNGVSTQDDFSPEKLLAQLELEKTEQPEQPEQPEKTEQAKEAKPKRNRAKEKLAKRKAEIEAIQAQARLELENSIDYKKIEQDSMNQILSLQNLKVFDIRPDGHCLFASIKDQLHERHQLDVSIDQLRLDAAKYMEGHKDDFEPFLFDPDTMQQHNLTEYLQELTTTAMWGSDLEIKALAHVFDCPIKVFVAGASPIHFNSEASLPELKLGFYKYSYGLGEHYNSLRDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.68
3 0.64
4 0.6
5 0.58
6 0.55
7 0.52
8 0.44
9 0.37
10 0.41
11 0.43
12 0.45
13 0.54
14 0.59
15 0.63
16 0.71
17 0.79
18 0.83
19 0.86
20 0.91
21 0.91
22 0.91
23 0.9
24 0.83
25 0.79
26 0.75
27 0.7
28 0.62
29 0.54
30 0.5
31 0.45
32 0.43
33 0.45
34 0.48
35 0.46
36 0.49
37 0.5
38 0.45
39 0.46
40 0.53
41 0.5
42 0.49
43 0.47
44 0.43
45 0.41
46 0.41
47 0.34
48 0.27
49 0.21
50 0.12
51 0.16
52 0.14
53 0.13
54 0.14
55 0.14
56 0.14
57 0.14
58 0.14
59 0.11
60 0.12
61 0.14
62 0.13
63 0.15
64 0.15
65 0.15
66 0.17
67 0.2
68 0.21
69 0.21
70 0.25
71 0.25
72 0.31
73 0.37
74 0.36
75 0.36
76 0.37
77 0.37
78 0.37
79 0.38
80 0.34
81 0.34
82 0.37
83 0.43
84 0.49
85 0.56
86 0.58
87 0.67
88 0.74
89 0.78
90 0.83
91 0.82
92 0.83
93 0.83
94 0.86
95 0.87
96 0.86
97 0.8
98 0.72
99 0.72
100 0.63
101 0.59
102 0.49
103 0.43
104 0.38
105 0.35
106 0.33
107 0.25
108 0.23
109 0.17
110 0.17
111 0.12
112 0.07
113 0.06
114 0.06
115 0.07
116 0.08
117 0.08
118 0.09
119 0.09
120 0.09
121 0.12
122 0.12
123 0.12
124 0.12
125 0.15
126 0.21
127 0.24
128 0.23
129 0.2
130 0.19
131 0.18
132 0.18
133 0.15
134 0.09
135 0.07
136 0.08
137 0.08
138 0.1
139 0.1
140 0.1
141 0.13
142 0.15
143 0.15
144 0.21
145 0.21
146 0.2
147 0.2
148 0.2
149 0.17
150 0.17
151 0.17
152 0.13
153 0.13
154 0.13
155 0.15
156 0.15
157 0.19
158 0.25
159 0.24
160 0.26
161 0.26
162 0.26
163 0.25
164 0.24
165 0.22
166 0.16
167 0.16
168 0.12
169 0.11
170 0.11
171 0.1
172 0.09
173 0.09
174 0.07
175 0.09
176 0.1
177 0.12
178 0.16
179 0.17
180 0.17
181 0.16
182 0.18
183 0.17
184 0.17
185 0.16
186 0.15
187 0.14
188 0.16
189 0.15
190 0.13
191 0.13
192 0.15
193 0.19
194 0.16
195 0.18
196 0.15
197 0.16
198 0.17
199 0.16
200 0.13
201 0.1
202 0.1
203 0.1
204 0.09
205 0.09
206 0.08
207 0.09
208 0.09
209 0.09
210 0.07
211 0.06
212 0.06
213 0.06
214 0.08
215 0.12
216 0.12
217 0.12
218 0.13
219 0.13
220 0.14
221 0.14
222 0.13
223 0.08
224 0.08
225 0.09
226 0.11
227 0.12
228 0.12
229 0.12
230 0.13
231 0.12
232 0.12
233 0.1
234 0.12
235 0.12
236 0.12
237 0.12
238 0.14
239 0.14
240 0.17
241 0.16
242 0.13
243 0.14
244 0.16
245 0.15
246 0.17
247 0.19
248 0.16
249 0.18
250 0.19
251 0.17
252 0.17
253 0.18
254 0.17
255 0.17
256 0.19
257 0.18
258 0.21
259 0.22
260 0.21
261 0.2
262 0.22
263 0.23
264 0.25
265 0.25