Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4RCQ0

Protein Details
Accession A0A1E4RCQ0    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
168-204SELELKGKSKSNRNRNRNRNRNRNRNRKRNRKRTKFYBasic
NLS Segment(s)
PositionSequence
173-202KGKSKSNRNRNRNRNRNRNRNRKRNRKRTK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR005162  Retrotrans_gag_dom  
Pfam View protein in Pfam  
PF03732  Retrotrans_gag  
Amino Acid Sequences MWILNVDNIIERTVKYYGNPYWVVLSLLKGEAERWLTRTSYQNASWHRIRESIVRRYVSSDYGLTLRREWNNLHQGRYSIYEYNMYTKKLLGKINVYEKFASKVGYTSLNLWLDENLIKRHYIMGLEEDYYLAVTDGVECPHPLEKIFKITGNRDMPQMGLSHRKWMSELELKGKSKSNRNRNRNRNRNRNRNRKRNRKRTKFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.22
4 0.24
5 0.29
6 0.3
7 0.27
8 0.28
9 0.27
10 0.28
11 0.22
12 0.2
13 0.15
14 0.15
15 0.15
16 0.12
17 0.12
18 0.14
19 0.17
20 0.17
21 0.18
22 0.19
23 0.2
24 0.23
25 0.3
26 0.31
27 0.32
28 0.34
29 0.38
30 0.41
31 0.47
32 0.47
33 0.44
34 0.41
35 0.38
36 0.37
37 0.39
38 0.42
39 0.43
40 0.46
41 0.45
42 0.43
43 0.45
44 0.45
45 0.37
46 0.31
47 0.23
48 0.18
49 0.19
50 0.21
51 0.18
52 0.19
53 0.22
54 0.21
55 0.24
56 0.24
57 0.3
58 0.37
59 0.38
60 0.38
61 0.34
62 0.34
63 0.33
64 0.34
65 0.29
66 0.2
67 0.18
68 0.19
69 0.18
70 0.24
71 0.24
72 0.21
73 0.19
74 0.19
75 0.22
76 0.23
77 0.25
78 0.21
79 0.23
80 0.26
81 0.35
82 0.36
83 0.33
84 0.3
85 0.28
86 0.28
87 0.25
88 0.21
89 0.13
90 0.11
91 0.1
92 0.12
93 0.12
94 0.11
95 0.15
96 0.15
97 0.15
98 0.14
99 0.13
100 0.12
101 0.13
102 0.13
103 0.11
104 0.11
105 0.11
106 0.11
107 0.11
108 0.11
109 0.1
110 0.09
111 0.1
112 0.1
113 0.11
114 0.11
115 0.1
116 0.09
117 0.09
118 0.08
119 0.05
120 0.04
121 0.03
122 0.04
123 0.05
124 0.06
125 0.06
126 0.06
127 0.08
128 0.1
129 0.1
130 0.1
131 0.14
132 0.15
133 0.2
134 0.22
135 0.24
136 0.26
137 0.29
138 0.37
139 0.38
140 0.38
141 0.34
142 0.33
143 0.29
144 0.26
145 0.24
146 0.18
147 0.22
148 0.22
149 0.29
150 0.29
151 0.29
152 0.29
153 0.29
154 0.33
155 0.32
156 0.35
157 0.34
158 0.41
159 0.42
160 0.44
161 0.5
162 0.49
163 0.51
164 0.59
165 0.62
166 0.66
167 0.75
168 0.84
169 0.88
170 0.93
171 0.94
172 0.95
173 0.95
174 0.95
175 0.96
176 0.96
177 0.96
178 0.96
179 0.96
180 0.96
181 0.96
182 0.97
183 0.97
184 0.97