Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RNY3

Protein Details
Accession A0A1E4RNY3    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
293-317TRLPNTQLKKSFKQKQNEKANHFAGHydrophilic
331-350EGTSRKRKPTSAWDKVKRRRBasic
NLS Segment(s)
PositionSequence
335-350RKRKPTSAWDKVKRRR
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007146  Sas10/Utp3/C1D  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MATRESVDQLLTGIAAAVETTTQSIQSIEQDHLDNEDTFPSIVQELMKKLGLDKLEGVSLLTLKNSSLLSYLNNLALIILSHLERLEEDCEFDKTESLKEKMVENSIIQRVSLEKGIKPLEKKLNYQIDKMVRSYNRMMEDETRIEAKISKESNKESGSESGSESGSESESEEEDDALSYRPDAAALAKLTKTSSKAKPSKSSEPSENAEAYKPPKISAVAPPSATFSEKGTDKSSNRKLQSMEEYLAENSELPQAEVSIGSSIVNNGRGGVKTDKDRQREEEIQTYEESNFTRLPNTQLKKSFKQKQNEKANHFAGEDWSMFNNNRNILEGTSRKRKPTSAWDKVKRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.06
8 0.06
9 0.07
10 0.07
11 0.08
12 0.09
13 0.13
14 0.15
15 0.15
16 0.17
17 0.19
18 0.19
19 0.21
20 0.22
21 0.19
22 0.17
23 0.17
24 0.15
25 0.14
26 0.13
27 0.12
28 0.1
29 0.1
30 0.11
31 0.13
32 0.14
33 0.17
34 0.19
35 0.18
36 0.19
37 0.22
38 0.21
39 0.19
40 0.19
41 0.18
42 0.17
43 0.17
44 0.16
45 0.12
46 0.13
47 0.11
48 0.09
49 0.08
50 0.08
51 0.1
52 0.1
53 0.09
54 0.09
55 0.1
56 0.11
57 0.13
58 0.15
59 0.13
60 0.13
61 0.13
62 0.11
63 0.11
64 0.09
65 0.07
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.07
72 0.08
73 0.1
74 0.09
75 0.11
76 0.12
77 0.14
78 0.15
79 0.15
80 0.16
81 0.15
82 0.19
83 0.22
84 0.23
85 0.24
86 0.24
87 0.27
88 0.27
89 0.29
90 0.26
91 0.22
92 0.26
93 0.26
94 0.25
95 0.21
96 0.19
97 0.18
98 0.18
99 0.21
100 0.17
101 0.15
102 0.19
103 0.24
104 0.27
105 0.27
106 0.33
107 0.39
108 0.4
109 0.42
110 0.46
111 0.53
112 0.51
113 0.51
114 0.5
115 0.46
116 0.45
117 0.43
118 0.4
119 0.31
120 0.33
121 0.34
122 0.32
123 0.3
124 0.29
125 0.29
126 0.25
127 0.28
128 0.25
129 0.23
130 0.2
131 0.17
132 0.16
133 0.17
134 0.15
135 0.18
136 0.19
137 0.23
138 0.25
139 0.27
140 0.32
141 0.3
142 0.3
143 0.26
144 0.26
145 0.23
146 0.21
147 0.19
148 0.15
149 0.14
150 0.13
151 0.11
152 0.09
153 0.08
154 0.07
155 0.07
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.05
162 0.05
163 0.05
164 0.05
165 0.05
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.06
173 0.07
174 0.09
175 0.09
176 0.09
177 0.1
178 0.11
179 0.14
180 0.19
181 0.24
182 0.33
183 0.39
184 0.44
185 0.53
186 0.58
187 0.64
188 0.64
189 0.63
190 0.57
191 0.55
192 0.53
193 0.47
194 0.41
195 0.32
196 0.27
197 0.25
198 0.23
199 0.22
200 0.2
201 0.17
202 0.18
203 0.18
204 0.19
205 0.25
206 0.28
207 0.26
208 0.26
209 0.26
210 0.27
211 0.27
212 0.25
213 0.18
214 0.14
215 0.15
216 0.16
217 0.18
218 0.19
219 0.25
220 0.26
221 0.35
222 0.43
223 0.48
224 0.48
225 0.5
226 0.48
227 0.47
228 0.52
229 0.46
230 0.38
231 0.31
232 0.3
233 0.26
234 0.25
235 0.19
236 0.13
237 0.09
238 0.11
239 0.1
240 0.08
241 0.08
242 0.08
243 0.08
244 0.08
245 0.08
246 0.06
247 0.06
248 0.06
249 0.06
250 0.07
251 0.08
252 0.1
253 0.09
254 0.1
255 0.12
256 0.12
257 0.16
258 0.19
259 0.22
260 0.27
261 0.37
262 0.44
263 0.48
264 0.52
265 0.53
266 0.58
267 0.6
268 0.59
269 0.58
270 0.53
271 0.49
272 0.45
273 0.42
274 0.33
275 0.28
276 0.24
277 0.18
278 0.17
279 0.16
280 0.17
281 0.17
282 0.23
283 0.31
284 0.36
285 0.41
286 0.48
287 0.56
288 0.62
289 0.71
290 0.75
291 0.74
292 0.79
293 0.81
294 0.83
295 0.87
296 0.87
297 0.84
298 0.82
299 0.78
300 0.7
301 0.6
302 0.51
303 0.42
304 0.36
305 0.3
306 0.23
307 0.2
308 0.2
309 0.21
310 0.25
311 0.27
312 0.26
313 0.26
314 0.28
315 0.28
316 0.27
317 0.35
318 0.37
319 0.41
320 0.48
321 0.52
322 0.55
323 0.58
324 0.6
325 0.59
326 0.63
327 0.66
328 0.66
329 0.73
330 0.77