Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H2B070

Protein Details
Accession H2B070   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
26-53AEQIPKESGNKEKRKRRRRNYDDYDAEVHydrophilic
NLS Segment(s)
PositionSequence
34-44GNKEKRKRRRR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR019098  Histone_chaperone_domain_CHZ  
Gene Ontology GO:0005634  C:nucleus  
KEGG kaf:KAFR_0I02410  -  
Pfam View protein in Pfam  
PF09649  CHZ  
Amino Acid Sequences MSDKVEDIKAETPKDENTHTSTETVAEQIPKESGNKEKRKRRRRNYDDYDAEVDKEEKENKLNKKSKKMGAAEEVDEDESDLDDEKLDMLIGNEAEEEDDLAEIDTSNIITGGRRTRGKVIDYKKTAELLDQGAQKDSSVAEEEEDDEDEDVDFKVDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.31
4 0.31
5 0.33
6 0.32
7 0.31
8 0.27
9 0.24
10 0.22
11 0.19
12 0.17
13 0.15
14 0.14
15 0.14
16 0.15
17 0.15
18 0.16
19 0.17
20 0.25
21 0.33
22 0.43
23 0.52
24 0.62
25 0.72
26 0.81
27 0.89
28 0.91
29 0.92
30 0.91
31 0.93
32 0.91
33 0.91
34 0.84
35 0.78
36 0.71
37 0.6
38 0.51
39 0.41
40 0.32
41 0.22
42 0.2
43 0.17
44 0.14
45 0.19
46 0.26
47 0.32
48 0.41
49 0.49
50 0.52
51 0.6
52 0.66
53 0.66
54 0.67
55 0.63
56 0.57
57 0.55
58 0.5
59 0.41
60 0.35
61 0.3
62 0.21
63 0.18
64 0.14
65 0.08
66 0.06
67 0.05
68 0.04
69 0.04
70 0.03
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.03
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.04
92 0.04
93 0.03
94 0.03
95 0.04
96 0.04
97 0.04
98 0.08
99 0.12
100 0.18
101 0.2
102 0.23
103 0.29
104 0.33
105 0.37
106 0.43
107 0.46
108 0.5
109 0.52
110 0.53
111 0.49
112 0.47
113 0.43
114 0.35
115 0.31
116 0.24
117 0.25
118 0.25
119 0.24
120 0.24
121 0.24
122 0.22
123 0.2
124 0.16
125 0.14
126 0.13
127 0.12
128 0.11
129 0.12
130 0.14
131 0.14
132 0.15
133 0.14
134 0.11
135 0.11
136 0.1
137 0.1
138 0.09