Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4RHW4

Protein Details
Accession A0A1E4RHW4    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
109-133ALKMHAKKVERLRKREKRNKLLKERBasic
NLS Segment(s)
PositionSequence
90-133ADLKRRREIKEEKERYAKIALKMHAKKVERLRKREKRNKLLKER
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSASSSHMEYKDIPKKYIDPLQPKDKSEGARVNGKEWKIKKDAFRVKTLGVKRMTTFEKREQERLEKQQYRARLNDLKQEKEDAKNQRIADLKRRREIKEEKERYAKIALKMHAKKVERLRKREKRNKLLKER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.45
4 0.5
5 0.49
6 0.5
7 0.55
8 0.63
9 0.65
10 0.64
11 0.62
12 0.58
13 0.52
14 0.49
15 0.49
16 0.42
17 0.45
18 0.44
19 0.44
20 0.45
21 0.44
22 0.44
23 0.4
24 0.43
25 0.4
26 0.44
27 0.46
28 0.51
29 0.59
30 0.55
31 0.57
32 0.53
33 0.5
34 0.52
35 0.49
36 0.45
37 0.38
38 0.35
39 0.31
40 0.33
41 0.35
42 0.32
43 0.34
44 0.36
45 0.42
46 0.42
47 0.46
48 0.45
49 0.48
50 0.5
51 0.53
52 0.55
53 0.51
54 0.52
55 0.51
56 0.53
57 0.5
58 0.45
59 0.43
60 0.4
61 0.37
62 0.42
63 0.43
64 0.4
65 0.37
66 0.4
67 0.36
68 0.34
69 0.4
70 0.39
71 0.38
72 0.41
73 0.4
74 0.41
75 0.45
76 0.44
77 0.47
78 0.5
79 0.52
80 0.54
81 0.6
82 0.58
83 0.61
84 0.67
85 0.67
86 0.68
87 0.68
88 0.68
89 0.71
90 0.69
91 0.63
92 0.61
93 0.55
94 0.5
95 0.5
96 0.47
97 0.49
98 0.53
99 0.57
100 0.58
101 0.56
102 0.57
103 0.61
104 0.68
105 0.67
106 0.72
107 0.76
108 0.78
109 0.87
110 0.9
111 0.91
112 0.91
113 0.92