Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RGI1

Protein Details
Accession A0A1E4RGI1    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-59ISTPQSSKSKKQIKKYPTPNNSSRPGHydrophilic
NLS Segment(s)
PositionSequence
83-91KKLMKEGKK
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020981  Csm1/Pcs1_C  
IPR038608  Csm1/Pcs1_C_sf  
Pfam View protein in Pfam  
PF12539  Csm1  
Amino Acid Sequences MAKTRNNTGTKIRKTSRVQEAEAGIESEKETEEISTPQSSKSKKQIKKYPTPNNSSRPGSSKTRPTSRSSSDKVNTTPGKITKKLMKEGKKREITEAEIVKSKDVKGLIAIMNSLVNNEQDEIYDKFKKQNEEVISKDEEIIREMSEKIEQQQDTIEQLIGMIPKKNSNESILQLNETPLKGKKLGEEYPDLSYNNTAQTTYESPIRKKKNITNQFTNEPELINEDQLNKELKTISIILDMLELLTGLRIVNYEEDESKFYFDVKQVNTNEKLTIHIEYKLIIQKDFEIAAEVNYLPTFLNDLEDDNEERRSVTGLFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.77
3 0.77
4 0.73
5 0.67
6 0.63
7 0.6
8 0.53
9 0.47
10 0.38
11 0.27
12 0.21
13 0.19
14 0.14
15 0.12
16 0.1
17 0.09
18 0.09
19 0.1
20 0.11
21 0.14
22 0.18
23 0.19
24 0.23
25 0.29
26 0.32
27 0.38
28 0.47
29 0.54
30 0.57
31 0.67
32 0.72
33 0.75
34 0.82
35 0.86
36 0.86
37 0.85
38 0.87
39 0.85
40 0.82
41 0.79
42 0.73
43 0.66
44 0.6
45 0.56
46 0.55
47 0.54
48 0.56
49 0.57
50 0.62
51 0.62
52 0.63
53 0.66
54 0.65
55 0.67
56 0.61
57 0.62
58 0.56
59 0.57
60 0.53
61 0.54
62 0.49
63 0.43
64 0.45
65 0.43
66 0.45
67 0.43
68 0.46
69 0.45
70 0.48
71 0.54
72 0.57
73 0.6
74 0.64
75 0.72
76 0.77
77 0.77
78 0.73
79 0.7
80 0.65
81 0.59
82 0.57
83 0.5
84 0.41
85 0.38
86 0.37
87 0.32
88 0.3
89 0.25
90 0.21
91 0.18
92 0.16
93 0.12
94 0.16
95 0.15
96 0.14
97 0.14
98 0.11
99 0.11
100 0.11
101 0.11
102 0.07
103 0.06
104 0.07
105 0.07
106 0.07
107 0.06
108 0.1
109 0.11
110 0.15
111 0.19
112 0.19
113 0.24
114 0.28
115 0.31
116 0.29
117 0.35
118 0.35
119 0.37
120 0.38
121 0.36
122 0.34
123 0.31
124 0.3
125 0.24
126 0.19
127 0.15
128 0.14
129 0.11
130 0.1
131 0.1
132 0.1
133 0.1
134 0.1
135 0.11
136 0.15
137 0.15
138 0.14
139 0.14
140 0.14
141 0.14
142 0.14
143 0.12
144 0.06
145 0.06
146 0.07
147 0.07
148 0.07
149 0.09
150 0.08
151 0.12
152 0.13
153 0.15
154 0.15
155 0.17
156 0.18
157 0.18
158 0.22
159 0.19
160 0.19
161 0.18
162 0.18
163 0.17
164 0.14
165 0.15
166 0.12
167 0.14
168 0.14
169 0.15
170 0.17
171 0.21
172 0.25
173 0.26
174 0.28
175 0.28
176 0.29
177 0.3
178 0.27
179 0.22
180 0.19
181 0.17
182 0.15
183 0.13
184 0.1
185 0.09
186 0.12
187 0.14
188 0.14
189 0.2
190 0.21
191 0.25
192 0.34
193 0.41
194 0.43
195 0.47
196 0.53
197 0.59
198 0.66
199 0.7
200 0.7
201 0.69
202 0.7
203 0.65
204 0.6
205 0.49
206 0.39
207 0.31
208 0.26
209 0.21
210 0.16
211 0.15
212 0.14
213 0.14
214 0.16
215 0.18
216 0.14
217 0.15
218 0.14
219 0.13
220 0.14
221 0.15
222 0.13
223 0.13
224 0.13
225 0.11
226 0.11
227 0.11
228 0.08
229 0.07
230 0.05
231 0.03
232 0.03
233 0.04
234 0.03
235 0.03
236 0.04
237 0.05
238 0.07
239 0.08
240 0.1
241 0.12
242 0.14
243 0.17
244 0.17
245 0.18
246 0.17
247 0.16
248 0.16
249 0.17
250 0.22
251 0.23
252 0.3
253 0.32
254 0.38
255 0.41
256 0.4
257 0.4
258 0.33
259 0.34
260 0.28
261 0.28
262 0.23
263 0.22
264 0.21
265 0.2
266 0.24
267 0.27
268 0.26
269 0.23
270 0.22
271 0.22
272 0.24
273 0.24
274 0.18
275 0.16
276 0.14
277 0.14
278 0.15
279 0.14
280 0.12
281 0.12
282 0.12
283 0.09
284 0.09
285 0.11
286 0.09
287 0.11
288 0.11
289 0.13
290 0.15
291 0.18
292 0.2
293 0.2
294 0.22
295 0.19
296 0.19
297 0.18
298 0.18