Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RDP3

Protein Details
Accession A0A1E4RDP3    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
174-206ILIPWVLQKKQPKKDKPRRRRRDKEIKEEEVKQBasic
NLS Segment(s)
PositionSequence
182-198KKQPKKDKPRRRRRDKE
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013216  Methyltransf_11  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF08241  Methyltransf_11  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MAVTSLRKEVSEEDPELQEQEHVHLVYNEIASHFSQTRYKPWPIVEKFLQNRQDYSIGIDVGCGNGKYLGVNDKLFMIGTDRSDGLIGCGKEVSANKYNLGVADGLSLPHQDNRFDFAISIAVIHHFTTEERRVQAIQHILGKLRTGGELLVYCWALEQENSRRGYKEGDDQDILIPWVLQKKQPKKDKPRRRRRDKEIKEEEVKQEEVKEEEVKEEEKDIKYRYYHLYKKGELHENALRAGNCTIVEEGYEKDNWWIIIRKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.31
4 0.28
5 0.23
6 0.17
7 0.17
8 0.18
9 0.16
10 0.16
11 0.16
12 0.17
13 0.18
14 0.18
15 0.16
16 0.12
17 0.14
18 0.13
19 0.17
20 0.17
21 0.17
22 0.22
23 0.24
24 0.31
25 0.36
26 0.39
27 0.4
28 0.44
29 0.52
30 0.49
31 0.55
32 0.53
33 0.56
34 0.57
35 0.61
36 0.63
37 0.54
38 0.52
39 0.47
40 0.44
41 0.35
42 0.33
43 0.27
44 0.2
45 0.18
46 0.17
47 0.13
48 0.12
49 0.13
50 0.09
51 0.07
52 0.07
53 0.07
54 0.07
55 0.08
56 0.12
57 0.14
58 0.14
59 0.14
60 0.14
61 0.14
62 0.14
63 0.12
64 0.11
65 0.09
66 0.1
67 0.11
68 0.11
69 0.11
70 0.11
71 0.11
72 0.1
73 0.13
74 0.12
75 0.11
76 0.11
77 0.1
78 0.13
79 0.14
80 0.18
81 0.2
82 0.21
83 0.21
84 0.22
85 0.22
86 0.19
87 0.19
88 0.13
89 0.07
90 0.08
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.1
97 0.11
98 0.11
99 0.11
100 0.15
101 0.16
102 0.15
103 0.14
104 0.11
105 0.11
106 0.1
107 0.1
108 0.06
109 0.05
110 0.06
111 0.06
112 0.05
113 0.05
114 0.05
115 0.1
116 0.12
117 0.14
118 0.14
119 0.15
120 0.15
121 0.15
122 0.19
123 0.17
124 0.16
125 0.17
126 0.17
127 0.17
128 0.17
129 0.16
130 0.13
131 0.11
132 0.09
133 0.07
134 0.06
135 0.06
136 0.06
137 0.07
138 0.07
139 0.07
140 0.07
141 0.06
142 0.07
143 0.06
144 0.06
145 0.1
146 0.15
147 0.21
148 0.24
149 0.25
150 0.26
151 0.26
152 0.29
153 0.27
154 0.29
155 0.27
156 0.29
157 0.28
158 0.28
159 0.27
160 0.25
161 0.23
162 0.14
163 0.1
164 0.07
165 0.12
166 0.12
167 0.17
168 0.26
169 0.35
170 0.45
171 0.56
172 0.65
173 0.72
174 0.82
175 0.89
176 0.91
177 0.93
178 0.94
179 0.96
180 0.96
181 0.95
182 0.95
183 0.94
184 0.94
185 0.92
186 0.9
187 0.84
188 0.79
189 0.73
190 0.66
191 0.57
192 0.47
193 0.39
194 0.32
195 0.28
196 0.25
197 0.23
198 0.19
199 0.2
200 0.21
201 0.2
202 0.19
203 0.21
204 0.24
205 0.23
206 0.28
207 0.28
208 0.31
209 0.31
210 0.35
211 0.4
212 0.44
213 0.49
214 0.54
215 0.59
216 0.58
217 0.64
218 0.67
219 0.68
220 0.59
221 0.59
222 0.55
223 0.49
224 0.47
225 0.44
226 0.36
227 0.29
228 0.28
229 0.24
230 0.18
231 0.18
232 0.17
233 0.12
234 0.13
235 0.12
236 0.14
237 0.15
238 0.15
239 0.14
240 0.15
241 0.17
242 0.17
243 0.2