Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RNY8

Protein Details
Accession A0A1E4RNY8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
113-138WRGDSRSKESKRFQRRKKLCDAIDRGBasic
NLS Segment(s)
PositionSequence
119-129SKESKRFQRRK
Subcellular Location(s) nucl 15, mito_nucl 13.333, mito 10.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR022210  TF_GCR1-like  
Gene Ontology GO:0110165  C:cellular anatomical entity  
Pfam View protein in Pfam  
PF12550  GCR1_C  
Amino Acid Sequences MWHKLLYKHKIIINNNLNHNNLNKINHLSIKLLTNKDPKNKPSQDASPSGGILTNSESATPTASTRRAKKPKISVEFLHNPMTVNEIYDEFNKGFRGQIPLKDMDDRYGKHEWRGDSRSKESKRFQRRKKLCDAIDRGCVRFNQSPEEIIRRIEEFRGDKSLTWIMNGNLPAELE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.64
3 0.63
4 0.6
5 0.54
6 0.51
7 0.47
8 0.42
9 0.38
10 0.33
11 0.32
12 0.34
13 0.35
14 0.35
15 0.31
16 0.28
17 0.32
18 0.35
19 0.33
20 0.36
21 0.41
22 0.46
23 0.53
24 0.58
25 0.57
26 0.61
27 0.63
28 0.61
29 0.59
30 0.59
31 0.55
32 0.53
33 0.51
34 0.42
35 0.37
36 0.33
37 0.27
38 0.2
39 0.15
40 0.13
41 0.12
42 0.1
43 0.1
44 0.11
45 0.09
46 0.11
47 0.1
48 0.1
49 0.11
50 0.17
51 0.22
52 0.28
53 0.39
54 0.47
55 0.52
56 0.58
57 0.65
58 0.69
59 0.7
60 0.68
61 0.6
62 0.59
63 0.59
64 0.54
65 0.48
66 0.38
67 0.32
68 0.27
69 0.27
70 0.19
71 0.13
72 0.11
73 0.09
74 0.1
75 0.1
76 0.11
77 0.09
78 0.1
79 0.1
80 0.1
81 0.09
82 0.1
83 0.16
84 0.16
85 0.19
86 0.22
87 0.23
88 0.24
89 0.27
90 0.26
91 0.23
92 0.26
93 0.23
94 0.24
95 0.28
96 0.28
97 0.28
98 0.32
99 0.31
100 0.34
101 0.39
102 0.41
103 0.4
104 0.47
105 0.53
106 0.54
107 0.6
108 0.61
109 0.67
110 0.71
111 0.76
112 0.79
113 0.81
114 0.85
115 0.85
116 0.87
117 0.86
118 0.8
119 0.8
120 0.78
121 0.71
122 0.71
123 0.65
124 0.56
125 0.49
126 0.43
127 0.39
128 0.37
129 0.34
130 0.31
131 0.3
132 0.32
133 0.33
134 0.39
135 0.33
136 0.29
137 0.3
138 0.26
139 0.27
140 0.25
141 0.29
142 0.25
143 0.28
144 0.33
145 0.32
146 0.3
147 0.33
148 0.37
149 0.3
150 0.29
151 0.28
152 0.23
153 0.27
154 0.27
155 0.23