Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4RMS2

Protein Details
Accession A0A1E4RMS2    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
53-84ELEMGSSKKRSKNKKSKVCVKKARKEHAPKSLHydrophilic
NLS Segment(s)
PositionSequence
60-83KKRSKNKKSKVCVKKARKEHAPKS
Subcellular Location(s) nucl 20, cyto_nucl 12.666, mito_nucl 12.166, cyto_mito 4.166, cyto 4
Family & Domain DBs
Amino Acid Sequences MGLLENKLDSLITMIYDKRLVQGLSSSSGSLQSKDSFQSGSNDGDNVEASSSELEMGSSKKRSKNKKSKVCVKKARKEHAPKSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.13
4 0.13
5 0.13
6 0.15
7 0.14
8 0.13
9 0.15
10 0.15
11 0.17
12 0.17
13 0.16
14 0.13
15 0.17
16 0.17
17 0.15
18 0.15
19 0.13
20 0.14
21 0.14
22 0.15
23 0.12
24 0.12
25 0.14
26 0.14
27 0.15
28 0.14
29 0.13
30 0.12
31 0.12
32 0.11
33 0.08
34 0.06
35 0.05
36 0.05
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.05
43 0.07
44 0.11
45 0.16
46 0.21
47 0.28
48 0.36
49 0.47
50 0.58
51 0.67
52 0.75
53 0.8
54 0.86
55 0.9
56 0.93
57 0.93
58 0.93
59 0.92
60 0.92
61 0.91
62 0.91
63 0.91
64 0.9