Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4RID6

Protein Details
Accession A0A1E4RID6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
58-81EEIKKINKANKIKKNKAINKKVEAHydrophilic
NLS Segment(s)
PositionSequence
61-85KKINKANKIKKNKAINKKVEANKKF
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR031404  Rrt14  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF17075  RRT14  
Amino Acid Sequences MSFKSKSSQTQARSTVNKLFANILPGSTVTDSPAVNSRLSSTEIINNQMNSKHKLSTEEIKKINKANKIKKNKAINKKVEANKKFNKLVKYNIIKNHKLDNSNELPEEERKYLQKLVKKNSSTLRRLTDIDDPDVKDEIDQLKAEILELTNEKYNKAKASKNNKLDKKSQDFNEKIKKGLISTPGLTPGLAPVGLDDDSDEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.6
3 0.58
4 0.54
5 0.46
6 0.43
7 0.36
8 0.36
9 0.32
10 0.25
11 0.19
12 0.18
13 0.19
14 0.16
15 0.15
16 0.12
17 0.14
18 0.13
19 0.14
20 0.2
21 0.19
22 0.18
23 0.18
24 0.18
25 0.18
26 0.21
27 0.21
28 0.17
29 0.21
30 0.22
31 0.26
32 0.26
33 0.25
34 0.24
35 0.27
36 0.29
37 0.28
38 0.29
39 0.27
40 0.26
41 0.3
42 0.33
43 0.38
44 0.42
45 0.45
46 0.48
47 0.49
48 0.51
49 0.53
50 0.54
51 0.53
52 0.55
53 0.58
54 0.62
55 0.7
56 0.75
57 0.77
58 0.82
59 0.83
60 0.84
61 0.84
62 0.82
63 0.78
64 0.79
65 0.78
66 0.77
67 0.73
68 0.71
69 0.68
70 0.67
71 0.66
72 0.61
73 0.6
74 0.52
75 0.52
76 0.53
77 0.52
78 0.51
79 0.53
80 0.56
81 0.52
82 0.51
83 0.52
84 0.46
85 0.42
86 0.38
87 0.36
88 0.33
89 0.31
90 0.3
91 0.23
92 0.21
93 0.21
94 0.23
95 0.17
96 0.16
97 0.15
98 0.18
99 0.23
100 0.25
101 0.28
102 0.32
103 0.39
104 0.46
105 0.46
106 0.49
107 0.52
108 0.57
109 0.55
110 0.53
111 0.48
112 0.43
113 0.43
114 0.4
115 0.38
116 0.33
117 0.32
118 0.3
119 0.27
120 0.26
121 0.25
122 0.22
123 0.16
124 0.16
125 0.14
126 0.13
127 0.12
128 0.11
129 0.11
130 0.11
131 0.12
132 0.1
133 0.08
134 0.08
135 0.09
136 0.11
137 0.15
138 0.15
139 0.16
140 0.18
141 0.21
142 0.25
143 0.29
144 0.35
145 0.4
146 0.51
147 0.6
148 0.67
149 0.75
150 0.76
151 0.77
152 0.79
153 0.79
154 0.76
155 0.74
156 0.71
157 0.72
158 0.69
159 0.72
160 0.74
161 0.66
162 0.59
163 0.55
164 0.49
165 0.41
166 0.42
167 0.38
168 0.32
169 0.33
170 0.33
171 0.33
172 0.31
173 0.29
174 0.23
175 0.19
176 0.16
177 0.13
178 0.11
179 0.08
180 0.11
181 0.11
182 0.11
183 0.1