Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RLI8

Protein Details
Accession A0A1E4RLI8    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-25QTYNSTPPPPKRRSAKDYQFGAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR039046  PDPK1  
IPR000719  Prot_kinase_dom  
IPR017441  Protein_kinase_ATP_BS  
IPR008271  Ser/Thr_kinase_AS  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0006468  P:protein phosphorylation  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS00107  PROTEIN_KINASE_ATP  
PS50011  PROTEIN_KINASE_DOM  
PS00108  PROTEIN_KINASE_ST  
CDD cd05581  STKc_PDK1  
Amino Acid Sequences MSQQTYNSTPPPPKRRSAKDYQFGATIGEGSYSTVYLALDIHNNKTFAIKVLSKRHIVKEDKIKYVNIEKTTLHRLGQQHPGIVQLYYTFQDEASLFFVLDFAEYGELLSIIRKFGSLNEIVSKFYMLQIVDAVKFIHLKGIIHRDLKPENILVGHDFQLKITDFGAAKLLGSNQDFIDNEKIDYNGITNEISLDLDRKGSFVGTAEYVAPELLKFNTCAFESDIWALGCILYQFFYGVPPFKGSTEYLTFEKIINVDYSYKQNHPMPKDVMNLIDSLLIAEPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.77
3 0.79
4 0.81
5 0.81
6 0.81
7 0.8
8 0.73
9 0.65
10 0.55
11 0.48
12 0.37
13 0.27
14 0.17
15 0.13
16 0.1
17 0.09
18 0.09
19 0.08
20 0.08
21 0.07
22 0.07
23 0.07
24 0.07
25 0.07
26 0.13
27 0.15
28 0.2
29 0.22
30 0.23
31 0.23
32 0.24
33 0.23
34 0.2
35 0.24
36 0.25
37 0.3
38 0.39
39 0.44
40 0.48
41 0.52
42 0.56
43 0.59
44 0.59
45 0.59
46 0.6
47 0.62
48 0.63
49 0.61
50 0.55
51 0.51
52 0.54
53 0.52
54 0.44
55 0.4
56 0.33
57 0.36
58 0.41
59 0.39
60 0.31
61 0.3
62 0.31
63 0.34
64 0.42
65 0.39
66 0.33
67 0.31
68 0.33
69 0.28
70 0.24
71 0.19
72 0.1
73 0.11
74 0.1
75 0.11
76 0.09
77 0.08
78 0.1
79 0.1
80 0.1
81 0.11
82 0.1
83 0.08
84 0.08
85 0.08
86 0.07
87 0.07
88 0.06
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.06
102 0.06
103 0.1
104 0.1
105 0.11
106 0.15
107 0.15
108 0.16
109 0.16
110 0.15
111 0.12
112 0.11
113 0.12
114 0.08
115 0.07
116 0.08
117 0.09
118 0.08
119 0.09
120 0.08
121 0.07
122 0.07
123 0.07
124 0.08
125 0.07
126 0.08
127 0.1
128 0.17
129 0.19
130 0.21
131 0.23
132 0.24
133 0.25
134 0.26
135 0.24
136 0.18
137 0.15
138 0.13
139 0.12
140 0.1
141 0.1
142 0.1
143 0.11
144 0.11
145 0.1
146 0.12
147 0.12
148 0.11
149 0.1
150 0.12
151 0.1
152 0.1
153 0.12
154 0.09
155 0.09
156 0.09
157 0.09
158 0.09
159 0.09
160 0.1
161 0.09
162 0.11
163 0.11
164 0.13
165 0.17
166 0.15
167 0.15
168 0.14
169 0.14
170 0.13
171 0.13
172 0.11
173 0.07
174 0.08
175 0.07
176 0.06
177 0.07
178 0.07
179 0.07
180 0.07
181 0.08
182 0.07
183 0.09
184 0.09
185 0.09
186 0.08
187 0.08
188 0.08
189 0.08
190 0.09
191 0.08
192 0.09
193 0.09
194 0.09
195 0.09
196 0.08
197 0.08
198 0.06
199 0.07
200 0.07
201 0.08
202 0.09
203 0.1
204 0.12
205 0.13
206 0.15
207 0.16
208 0.16
209 0.17
210 0.17
211 0.19
212 0.17
213 0.16
214 0.14
215 0.11
216 0.11
217 0.09
218 0.08
219 0.06
220 0.06
221 0.06
222 0.06
223 0.08
224 0.1
225 0.13
226 0.13
227 0.16
228 0.17
229 0.17
230 0.2
231 0.19
232 0.23
233 0.24
234 0.27
235 0.25
236 0.26
237 0.27
238 0.24
239 0.25
240 0.2
241 0.18
242 0.15
243 0.16
244 0.17
245 0.18
246 0.24
247 0.27
248 0.29
249 0.34
250 0.38
251 0.44
252 0.46
253 0.51
254 0.5
255 0.5
256 0.53
257 0.49
258 0.45
259 0.38
260 0.34
261 0.26
262 0.22
263 0.17
264 0.13