Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RFD7

Protein Details
Accession A0A1E4RFD7   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MKDRANRHDDKVQRKRRRQIARSRNFNLFNHydrophilic
NLS Segment(s)
PositionSequence
14-18RKRRR
Subcellular Location(s) nucl 19.5, mito_nucl 12, mito 3.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
Pfam View protein in Pfam  
PF03452  Anp1  
Amino Acid Sequences MKDRANRHDDKVQRKRRRQIARSRNFNLFNGLANERYTLFIDSDIVSIDHPKMIHHFINLKKDILVPRIARAENPDYDKNSWRGERTKPTKNQLEKMNQNDWDNWDYVPRDVTENMFHLQSFVENPVSTLETYLVPLDSVGGAILFAKSIIYKQGVVFPPNYIIGTTWERFEGYDGIETEGLCYIAKSLGYSCWGMPNLLAQHDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.88
3 0.89
4 0.92
5 0.9
6 0.91
7 0.91
8 0.9
9 0.9
10 0.85
11 0.84
12 0.76
13 0.67
14 0.61
15 0.51
16 0.43
17 0.37
18 0.34
19 0.27
20 0.24
21 0.24
22 0.19
23 0.19
24 0.18
25 0.15
26 0.13
27 0.12
28 0.13
29 0.12
30 0.12
31 0.11
32 0.1
33 0.08
34 0.1
35 0.1
36 0.1
37 0.09
38 0.1
39 0.13
40 0.17
41 0.18
42 0.19
43 0.26
44 0.29
45 0.38
46 0.39
47 0.36
48 0.32
49 0.35
50 0.35
51 0.31
52 0.32
53 0.24
54 0.25
55 0.3
56 0.29
57 0.26
58 0.28
59 0.29
60 0.27
61 0.31
62 0.31
63 0.3
64 0.32
65 0.35
66 0.33
67 0.33
68 0.32
69 0.3
70 0.32
71 0.35
72 0.43
73 0.46
74 0.52
75 0.54
76 0.6
77 0.65
78 0.65
79 0.65
80 0.62
81 0.63
82 0.6
83 0.6
84 0.57
85 0.5
86 0.47
87 0.42
88 0.37
89 0.3
90 0.25
91 0.19
92 0.16
93 0.14
94 0.13
95 0.13
96 0.11
97 0.11
98 0.11
99 0.12
100 0.11
101 0.12
102 0.13
103 0.12
104 0.12
105 0.1
106 0.1
107 0.09
108 0.08
109 0.08
110 0.08
111 0.08
112 0.09
113 0.09
114 0.1
115 0.1
116 0.09
117 0.09
118 0.08
119 0.08
120 0.08
121 0.07
122 0.06
123 0.06
124 0.06
125 0.05
126 0.04
127 0.04
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.04
136 0.04
137 0.07
138 0.08
139 0.1
140 0.1
141 0.18
142 0.21
143 0.23
144 0.23
145 0.22
146 0.22
147 0.22
148 0.22
149 0.14
150 0.12
151 0.15
152 0.2
153 0.2
154 0.18
155 0.18
156 0.18
157 0.18
158 0.19
159 0.16
160 0.12
161 0.16
162 0.16
163 0.17
164 0.18
165 0.17
166 0.16
167 0.15
168 0.14
169 0.1
170 0.09
171 0.07
172 0.08
173 0.09
174 0.09
175 0.09
176 0.11
177 0.14
178 0.16
179 0.15
180 0.2
181 0.21
182 0.2
183 0.19
184 0.24
185 0.23