Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RN41

Protein Details
Accession A0A1E4RN41    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MRNSILVKRNIKKKRKEFLEDEKVLVHydrophilic
NLS Segment(s)
PositionSequence
10-16NIKKKRK
Subcellular Location(s) mito_nucl 13.333, mito 13, nucl 12.5, cyto_mito 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR023610  PInositol-4-P-5-kinase  
IPR002498  PInositol-4-P-5-kinase_core  
IPR027484  PInositol-4-P-5-kinase_N  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016307  F:phosphatidylinositol phosphate kinase activity  
Pfam View protein in Pfam  
PF01504  PIP5K  
PROSITE View protein in PROSITE  
PS51455  PIPK  
CDD cd17303  PIPKc_PIP5K_yeast_like  
Amino Acid Sequences MRNSILVKRNIKKKRKEFLEDEKVLVGNKISEGHENFVMAYNMLTGIRVAVSRCSGIMKKLNDEDFKSTKKLSFNMDGSELTPSSKYDFKFKDYCPEVFRELRNMFGLDPADYLVSITGKYILSELGSPGKSGSFFYYSRDYRFIIKTIHHSEHKQLRRILKDYYNHVKENPNTLISQFYGLHRVKMPFLTGSKKIHFIVMNNLFPPHRDIHLKYDLKGSTWGRTTKINSNKEDLSSLTLKDLNFLERNDSIKFGPNKKSLFFKQLESDVKLLKKINVMDYSLLLGIHDVKKGNNSNFEKLSVFDPKSSDKFELIKTNPRDIDRENDLPTNVYPGRSKYVFYGHDGGIRSTNELNEPLNEIYYLGIIDCLTNYSTKKKLETFWRSLGHQRSTISALPANEYGDRFLKFIKDGTSKVKQKIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.89
4 0.88
5 0.88
6 0.89
7 0.81
8 0.72
9 0.63
10 0.54
11 0.45
12 0.37
13 0.27
14 0.17
15 0.16
16 0.17
17 0.16
18 0.22
19 0.23
20 0.26
21 0.26
22 0.25
23 0.24
24 0.23
25 0.22
26 0.16
27 0.13
28 0.1
29 0.1
30 0.1
31 0.09
32 0.06
33 0.06
34 0.07
35 0.08
36 0.09
37 0.11
38 0.13
39 0.13
40 0.14
41 0.18
42 0.19
43 0.24
44 0.31
45 0.31
46 0.36
47 0.41
48 0.48
49 0.47
50 0.49
51 0.5
52 0.49
53 0.5
54 0.47
55 0.43
56 0.41
57 0.41
58 0.41
59 0.4
60 0.42
61 0.4
62 0.4
63 0.39
64 0.36
65 0.32
66 0.32
67 0.25
68 0.18
69 0.17
70 0.14
71 0.15
72 0.19
73 0.19
74 0.25
75 0.28
76 0.33
77 0.4
78 0.4
79 0.47
80 0.48
81 0.51
82 0.45
83 0.46
84 0.45
85 0.43
86 0.43
87 0.41
88 0.37
89 0.36
90 0.34
91 0.31
92 0.25
93 0.23
94 0.22
95 0.14
96 0.14
97 0.12
98 0.1
99 0.09
100 0.09
101 0.07
102 0.06
103 0.06
104 0.06
105 0.07
106 0.07
107 0.08
108 0.08
109 0.07
110 0.08
111 0.08
112 0.09
113 0.12
114 0.13
115 0.13
116 0.13
117 0.13
118 0.13
119 0.13
120 0.15
121 0.14
122 0.14
123 0.17
124 0.25
125 0.26
126 0.28
127 0.3
128 0.28
129 0.28
130 0.3
131 0.3
132 0.25
133 0.26
134 0.31
135 0.34
136 0.38
137 0.37
138 0.37
139 0.42
140 0.49
141 0.53
142 0.52
143 0.5
144 0.52
145 0.55
146 0.55
147 0.53
148 0.5
149 0.48
150 0.49
151 0.54
152 0.51
153 0.47
154 0.46
155 0.47
156 0.42
157 0.44
158 0.39
159 0.3
160 0.26
161 0.25
162 0.24
163 0.18
164 0.19
165 0.13
166 0.12
167 0.19
168 0.19
169 0.2
170 0.21
171 0.22
172 0.2
173 0.2
174 0.2
175 0.15
176 0.17
177 0.2
178 0.21
179 0.24
180 0.25
181 0.27
182 0.26
183 0.27
184 0.25
185 0.22
186 0.27
187 0.28
188 0.27
189 0.25
190 0.26
191 0.22
192 0.22
193 0.24
194 0.16
195 0.13
196 0.16
197 0.17
198 0.23
199 0.33
200 0.33
201 0.31
202 0.35
203 0.33
204 0.31
205 0.34
206 0.29
207 0.23
208 0.26
209 0.26
210 0.22
211 0.26
212 0.28
213 0.31
214 0.4
215 0.43
216 0.41
217 0.44
218 0.43
219 0.4
220 0.37
221 0.29
222 0.24
223 0.19
224 0.17
225 0.14
226 0.16
227 0.15
228 0.16
229 0.16
230 0.15
231 0.16
232 0.16
233 0.18
234 0.17
235 0.2
236 0.18
237 0.19
238 0.17
239 0.22
240 0.27
241 0.3
242 0.36
243 0.39
244 0.41
245 0.41
246 0.47
247 0.43
248 0.45
249 0.41
250 0.36
251 0.34
252 0.39
253 0.41
254 0.36
255 0.35
256 0.31
257 0.3
258 0.3
259 0.28
260 0.24
261 0.24
262 0.23
263 0.27
264 0.25
265 0.25
266 0.23
267 0.22
268 0.21
269 0.17
270 0.15
271 0.1
272 0.08
273 0.1
274 0.1
275 0.12
276 0.12
277 0.12
278 0.18
279 0.25
280 0.27
281 0.33
282 0.37
283 0.4
284 0.4
285 0.42
286 0.36
287 0.32
288 0.33
289 0.3
290 0.27
291 0.24
292 0.25
293 0.28
294 0.3
295 0.33
296 0.31
297 0.26
298 0.28
299 0.3
300 0.37
301 0.35
302 0.42
303 0.42
304 0.48
305 0.48
306 0.47
307 0.47
308 0.41
309 0.44
310 0.41
311 0.42
312 0.38
313 0.36
314 0.34
315 0.32
316 0.3
317 0.3
318 0.24
319 0.22
320 0.21
321 0.22
322 0.28
323 0.27
324 0.28
325 0.24
326 0.31
327 0.31
328 0.33
329 0.35
330 0.3
331 0.33
332 0.34
333 0.32
334 0.28
335 0.27
336 0.25
337 0.21
338 0.22
339 0.19
340 0.2
341 0.2
342 0.17
343 0.2
344 0.18
345 0.17
346 0.16
347 0.14
348 0.12
349 0.11
350 0.1
351 0.06
352 0.06
353 0.06
354 0.06
355 0.06
356 0.07
357 0.08
358 0.11
359 0.13
360 0.19
361 0.25
362 0.28
363 0.34
364 0.37
365 0.43
366 0.51
367 0.59
368 0.6
369 0.62
370 0.63
371 0.61
372 0.66
373 0.66
374 0.61
375 0.55
376 0.48
377 0.44
378 0.44
379 0.43
380 0.38
381 0.34
382 0.29
383 0.29
384 0.29
385 0.28
386 0.26
387 0.24
388 0.24
389 0.24
390 0.24
391 0.22
392 0.22
393 0.23
394 0.23
395 0.25
396 0.3
397 0.31
398 0.34
399 0.42
400 0.5
401 0.54