Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RLS6

Protein Details
Accession A0A1E4RLS6   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
44-64TAIKCSFKAEDKNRRLQRFREHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 7.5, cyto_nucl 7.333, cyto 6, cyto_mito 5.833, mito 4.5, pero 3, extr 2, E.R. 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024977  Apc4-like_WD40_dom  
IPR045260  Sec12-like  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR036322  WD40_repeat_dom_sf  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0000139  C:Golgi membrane  
GO:0005096  F:GTPase activator activity  
GO:0005085  F:guanyl-nucleotide exchange factor activity  
GO:0006888  P:endoplasmic reticulum to Golgi vesicle-mediated transport  
GO:0009306  P:protein secretion  
GO:0003400  P:regulation of COPII vesicle coating  
Pfam View protein in Pfam  
PF12894  ANAPC4_WD40  
Amino Acid Sequences MSVKDSAVINVGYPIYGSKFINNKTLVTIGGGGEGKNGIPNKITAIKCSFKAEDKNRRLQRFREIELPANEDCPMCLDVAKIPDDDSEISITSNSKSNNYNVFFGCNQSSQLIKSMNINNNIRKYVFTQNEHLQFIDGAQFDDNITNESVGEYPKIIALSPNSSVGCFMTSAIPSSICVFKPDTLDITFKFTPEKEVEIKDFHLSPNDDGKTLCYITSNSIETFSTVTGNVISSTSSDPAITKILNNFILSKVRFIDNSNVIVTGGNRGGKPGASIFQFNLAEKKIVKRKQISSKVRGIVALDFNLPKDLIAMAGNDFSVILVRLSDFKNLKVFTKLHDFAVTTLSFSPNGLSLATGSASNSLLVLKLPPNFAKGKSTIGTILNYLILTIFIALLGIFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.15
4 0.16
5 0.2
6 0.27
7 0.3
8 0.38
9 0.38
10 0.36
11 0.36
12 0.36
13 0.3
14 0.24
15 0.24
16 0.16
17 0.18
18 0.18
19 0.15
20 0.14
21 0.14
22 0.13
23 0.16
24 0.17
25 0.14
26 0.15
27 0.15
28 0.2
29 0.28
30 0.28
31 0.29
32 0.35
33 0.37
34 0.38
35 0.44
36 0.42
37 0.4
38 0.5
39 0.55
40 0.59
41 0.63
42 0.72
43 0.75
44 0.81
45 0.81
46 0.76
47 0.76
48 0.73
49 0.68
50 0.66
51 0.61
52 0.59
53 0.56
54 0.55
55 0.44
56 0.38
57 0.35
58 0.26
59 0.22
60 0.17
61 0.15
62 0.11
63 0.1
64 0.1
65 0.12
66 0.15
67 0.17
68 0.14
69 0.14
70 0.14
71 0.16
72 0.16
73 0.15
74 0.13
75 0.12
76 0.12
77 0.12
78 0.12
79 0.11
80 0.14
81 0.14
82 0.16
83 0.18
84 0.22
85 0.29
86 0.31
87 0.33
88 0.3
89 0.33
90 0.3
91 0.31
92 0.29
93 0.22
94 0.2
95 0.18
96 0.19
97 0.15
98 0.19
99 0.18
100 0.16
101 0.21
102 0.28
103 0.32
104 0.39
105 0.43
106 0.44
107 0.46
108 0.48
109 0.42
110 0.36
111 0.35
112 0.37
113 0.38
114 0.36
115 0.38
116 0.43
117 0.46
118 0.46
119 0.41
120 0.32
121 0.25
122 0.23
123 0.2
124 0.14
125 0.1
126 0.09
127 0.1
128 0.09
129 0.11
130 0.1
131 0.08
132 0.08
133 0.07
134 0.07
135 0.08
136 0.08
137 0.07
138 0.08
139 0.06
140 0.06
141 0.07
142 0.08
143 0.07
144 0.08
145 0.09
146 0.11
147 0.12
148 0.14
149 0.13
150 0.13
151 0.14
152 0.12
153 0.11
154 0.09
155 0.08
156 0.07
157 0.07
158 0.09
159 0.09
160 0.08
161 0.08
162 0.1
163 0.11
164 0.1
165 0.12
166 0.12
167 0.13
168 0.15
169 0.15
170 0.16
171 0.15
172 0.17
173 0.15
174 0.21
175 0.19
176 0.18
177 0.18
178 0.16
179 0.18
180 0.18
181 0.2
182 0.16
183 0.18
184 0.2
185 0.2
186 0.21
187 0.18
188 0.18
189 0.15
190 0.16
191 0.15
192 0.15
193 0.2
194 0.19
195 0.18
196 0.18
197 0.19
198 0.17
199 0.17
200 0.15
201 0.09
202 0.1
203 0.11
204 0.14
205 0.14
206 0.12
207 0.13
208 0.12
209 0.12
210 0.12
211 0.1
212 0.08
213 0.07
214 0.07
215 0.06
216 0.06
217 0.06
218 0.06
219 0.05
220 0.06
221 0.07
222 0.08
223 0.08
224 0.08
225 0.08
226 0.09
227 0.1
228 0.09
229 0.09
230 0.1
231 0.13
232 0.14
233 0.15
234 0.15
235 0.15
236 0.2
237 0.19
238 0.19
239 0.18
240 0.18
241 0.18
242 0.19
243 0.24
244 0.21
245 0.23
246 0.22
247 0.2
248 0.19
249 0.19
250 0.17
251 0.13
252 0.12
253 0.12
254 0.12
255 0.12
256 0.13
257 0.12
258 0.13
259 0.12
260 0.13
261 0.12
262 0.14
263 0.13
264 0.19
265 0.2
266 0.19
267 0.21
268 0.19
269 0.2
270 0.2
271 0.28
272 0.31
273 0.36
274 0.44
275 0.49
276 0.57
277 0.65
278 0.75
279 0.76
280 0.74
281 0.77
282 0.72
283 0.65
284 0.57
285 0.48
286 0.41
287 0.34
288 0.27
289 0.21
290 0.18
291 0.18
292 0.18
293 0.16
294 0.12
295 0.1
296 0.09
297 0.07
298 0.08
299 0.08
300 0.08
301 0.08
302 0.08
303 0.07
304 0.07
305 0.06
306 0.06
307 0.06
308 0.05
309 0.05
310 0.06
311 0.09
312 0.11
313 0.18
314 0.19
315 0.2
316 0.27
317 0.28
318 0.3
319 0.33
320 0.33
321 0.3
322 0.39
323 0.38
324 0.34
325 0.35
326 0.34
327 0.28
328 0.32
329 0.28
330 0.19
331 0.19
332 0.19
333 0.16
334 0.15
335 0.15
336 0.11
337 0.12
338 0.1
339 0.09
340 0.08
341 0.09
342 0.1
343 0.09
344 0.08
345 0.09
346 0.1
347 0.09
348 0.09
349 0.08
350 0.08
351 0.08
352 0.11
353 0.13
354 0.16
355 0.21
356 0.22
357 0.26
358 0.29
359 0.31
360 0.34
361 0.33
362 0.36
363 0.32
364 0.34
365 0.33
366 0.32
367 0.32
368 0.27
369 0.26
370 0.21
371 0.19
372 0.17
373 0.13
374 0.1
375 0.08
376 0.07
377 0.06
378 0.04
379 0.05