Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H2AWC4

Protein Details
Accession H2AWC4   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
60-84VTNNDPKKKITKKFLKKKPMMNKVVHydrophilic
NLS Segment(s)
PositionSequence
66-77KKKITKKFLKKK
148-157SLKKNKKSKK
Subcellular Location(s) nucl 20.5, mito_nucl 12.833, cyto_nucl 12.666, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
KEGG kaf:KAFR_0F00770  -  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MSNVTGKLSNRVMNMKFMKFSNDDASTTSADSSRSASVNSRTNNSKFHDNSEWYTTNSTVTNNDPKKKITKKFLKKKPMMNKVVTSNVSFTTLKQGKTVADEDTIHMKTLNKGRMVFGDKKRTAEEEKLQENENDDDDYELDKMFKASLKKNKKSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.43
3 0.41
4 0.38
5 0.4
6 0.35
7 0.37
8 0.35
9 0.32
10 0.3
11 0.29
12 0.31
13 0.26
14 0.25
15 0.22
16 0.16
17 0.14
18 0.14
19 0.14
20 0.13
21 0.13
22 0.14
23 0.17
24 0.21
25 0.27
26 0.29
27 0.31
28 0.35
29 0.37
30 0.41
31 0.41
32 0.44
33 0.38
34 0.42
35 0.44
36 0.41
37 0.42
38 0.44
39 0.41
40 0.33
41 0.34
42 0.28
43 0.23
44 0.21
45 0.18
46 0.14
47 0.16
48 0.24
49 0.28
50 0.32
51 0.33
52 0.34
53 0.43
54 0.49
55 0.53
56 0.54
57 0.6
58 0.66
59 0.75
60 0.82
61 0.84
62 0.81
63 0.84
64 0.83
65 0.83
66 0.78
67 0.7
68 0.64
69 0.56
70 0.55
71 0.47
72 0.37
73 0.28
74 0.23
75 0.23
76 0.2
77 0.16
78 0.21
79 0.23
80 0.23
81 0.23
82 0.23
83 0.2
84 0.23
85 0.24
86 0.16
87 0.15
88 0.15
89 0.16
90 0.2
91 0.2
92 0.17
93 0.17
94 0.16
95 0.19
96 0.25
97 0.29
98 0.27
99 0.27
100 0.28
101 0.33
102 0.38
103 0.42
104 0.43
105 0.49
106 0.48
107 0.5
108 0.5
109 0.49
110 0.48
111 0.46
112 0.47
113 0.44
114 0.47
115 0.47
116 0.46
117 0.43
118 0.41
119 0.36
120 0.29
121 0.22
122 0.17
123 0.16
124 0.15
125 0.16
126 0.13
127 0.11
128 0.1
129 0.1
130 0.1
131 0.1
132 0.14
133 0.19
134 0.28
135 0.38
136 0.49
137 0.58