Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TMS8

Protein Details
Accession A0A1E4TMS8   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-42IGRKHPWRMSSMRKYRHRKRMETVDSNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, mito_nucl 13.5, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MVSDTKICKNICATNIGRKHPWRMSSMRKYRHRKRMETVDSNIEILKTSLESKGETFKRLDEFMQKVPKQKDMKPYDKYFVFNKTAKGYRKGIHLTHRWTKKTIRNPPEGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.48
3 0.51
4 0.53
5 0.51
6 0.58
7 0.56
8 0.56
9 0.52
10 0.54
11 0.59
12 0.62
13 0.68
14 0.7
15 0.74
16 0.81
17 0.85
18 0.88
19 0.86
20 0.82
21 0.81
22 0.82
23 0.81
24 0.77
25 0.71
26 0.66
27 0.58
28 0.51
29 0.42
30 0.31
31 0.22
32 0.15
33 0.12
34 0.06
35 0.07
36 0.07
37 0.08
38 0.09
39 0.09
40 0.17
41 0.17
42 0.19
43 0.18
44 0.19
45 0.2
46 0.2
47 0.21
48 0.19
49 0.21
50 0.25
51 0.33
52 0.33
53 0.39
54 0.4
55 0.47
56 0.46
57 0.47
58 0.52
59 0.52
60 0.59
61 0.59
62 0.61
63 0.59
64 0.57
65 0.55
66 0.48
67 0.46
68 0.43
69 0.38
70 0.37
71 0.38
72 0.43
73 0.45
74 0.48
75 0.47
76 0.44
77 0.49
78 0.51
79 0.5
80 0.52
81 0.55
82 0.58
83 0.62
84 0.68
85 0.64
86 0.63
87 0.66
88 0.67
89 0.7
90 0.72
91 0.72