Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4TJS9

Protein Details
Accession A0A1E4TJS9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKKSSRTPQKRVRVALDTHydrophilic
NLS Segment(s)
PositionSequence
4-7RKKS
Subcellular Location(s) mito 19.5, mito_nucl 12.333, cyto_nucl 4.333, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRTPQKRVRVALDTVFSCPFCNHEKSVTCTMDKKLGVGTLSCKVCGQDFQAPINSLSAPIDVYSEWIDACEAVADNDFDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.81
3 0.74
4 0.67
5 0.6
6 0.54
7 0.44
8 0.38
9 0.33
10 0.27
11 0.22
12 0.19
13 0.18
14 0.18
15 0.2
16 0.19
17 0.23
18 0.26
19 0.3
20 0.37
21 0.36
22 0.34
23 0.33
24 0.33
25 0.33
26 0.3
27 0.25
28 0.18
29 0.17
30 0.16
31 0.14
32 0.15
33 0.15
34 0.15
35 0.15
36 0.15
37 0.14
38 0.14
39 0.15
40 0.17
41 0.17
42 0.19
43 0.2
44 0.23
45 0.24
46 0.24
47 0.24
48 0.2
49 0.14
50 0.13
51 0.11
52 0.08
53 0.07
54 0.08
55 0.06
56 0.09
57 0.09
58 0.09
59 0.09
60 0.09
61 0.09
62 0.08
63 0.08
64 0.07
65 0.06
66 0.07
67 0.08