Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4TLY5

Protein Details
Accession A0A1E4TLY5    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKRNPRKLRWTKAFRKAAGKEBasic
54-74RIEQIRKKRERAFYKNRMRGNBasic
NLS Segment(s)
PositionSequence
6-12RKLRWTK
59-74RKKRERAFYKNRMRGN
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MKRNPRKLRWTKAFRKAAGKEMVVDSSLMFAARRNEPVRYNRELVQTTLDAMERIEQIRKKRERAFYKNRMRGNKSKDLAEDKKLVESHPEILRQLDVEVRRAAAKQATLLEQTSEEDIAMEETAIETEQPIAIKLKNKRKNKVNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.76
4 0.74
5 0.69
6 0.59
7 0.51
8 0.44
9 0.4
10 0.3
11 0.27
12 0.18
13 0.13
14 0.12
15 0.09
16 0.07
17 0.08
18 0.12
19 0.15
20 0.21
21 0.22
22 0.25
23 0.31
24 0.39
25 0.43
26 0.44
27 0.44
28 0.42
29 0.46
30 0.44
31 0.39
32 0.35
33 0.29
34 0.24
35 0.22
36 0.18
37 0.12
38 0.11
39 0.11
40 0.09
41 0.1
42 0.14
43 0.16
44 0.22
45 0.31
46 0.36
47 0.41
48 0.48
49 0.56
50 0.62
51 0.68
52 0.74
53 0.75
54 0.8
55 0.81
56 0.8
57 0.77
58 0.74
59 0.71
60 0.68
61 0.66
62 0.57
63 0.52
64 0.49
65 0.5
66 0.47
67 0.43
68 0.39
69 0.3
70 0.32
71 0.31
72 0.28
73 0.23
74 0.21
75 0.22
76 0.21
77 0.22
78 0.19
79 0.19
80 0.19
81 0.16
82 0.15
83 0.14
84 0.13
85 0.14
86 0.14
87 0.14
88 0.15
89 0.15
90 0.16
91 0.14
92 0.14
93 0.13
94 0.15
95 0.16
96 0.17
97 0.17
98 0.16
99 0.14
100 0.15
101 0.14
102 0.12
103 0.1
104 0.08
105 0.08
106 0.08
107 0.07
108 0.06
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.04
115 0.05
116 0.06
117 0.07
118 0.08
119 0.1
120 0.14
121 0.22
122 0.31
123 0.42
124 0.5
125 0.6
126 0.68