Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H2AZQ3

Protein Details
Accession H2AZQ3   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
79-100KGHSCYRPRRAGERKRKSVRGABasic
178-203LVTPQRLQRKRYQRSLKVKNAQAQREHydrophilic
NLS Segment(s)
PositionSequence
86-96PRRAGERKRKS
214-236KRLAEKKAEKAEIRKRRASSLKA
Subcellular Location(s) cyto_nucl 13.333, cyto 13, nucl 11.5, mito_nucl 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
IPR018282  Ribosomal_S6e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG kaf:KAFR_0I00720  -  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
PROSITE View protein in PROSITE  
PS00578  RIBOSOMAL_S6E  
Amino Acid Sequences MKLNIAYPVNGTQKTVEIDDEHRIRVFYDKRIGQEVDGESVGDEFKGYTFKISGGNDKQGFPMKQGVLLPTRVKLLLAKGHSCYRPRRAGERKRKSVRGAIVGPDLAVLSLVITKKGEQELEGVTDATVPKRLGPKRANNIRKFFGLTKEDDVRDFVIRREVTKGEKTYTKAPKIQRLVTPQRLQRKRYQRSLKVKNAQAQREAAAEYAQLLAKRLAEKKAEKAEIRKRRASSLKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.23
4 0.2
5 0.23
6 0.3
7 0.31
8 0.3
9 0.28
10 0.27
11 0.26
12 0.31
13 0.32
14 0.31
15 0.37
16 0.39
17 0.41
18 0.46
19 0.46
20 0.38
21 0.4
22 0.35
23 0.29
24 0.25
25 0.22
26 0.16
27 0.16
28 0.15
29 0.09
30 0.07
31 0.05
32 0.05
33 0.07
34 0.07
35 0.08
36 0.09
37 0.1
38 0.15
39 0.17
40 0.25
41 0.27
42 0.35
43 0.35
44 0.36
45 0.37
46 0.39
47 0.38
48 0.31
49 0.34
50 0.26
51 0.27
52 0.27
53 0.27
54 0.23
55 0.26
56 0.25
57 0.2
58 0.21
59 0.18
60 0.17
61 0.16
62 0.17
63 0.19
64 0.21
65 0.22
66 0.23
67 0.29
68 0.32
69 0.36
70 0.39
71 0.41
72 0.46
73 0.47
74 0.54
75 0.6
76 0.67
77 0.73
78 0.77
79 0.81
80 0.8
81 0.83
82 0.76
83 0.73
84 0.66
85 0.61
86 0.52
87 0.44
88 0.37
89 0.31
90 0.27
91 0.2
92 0.15
93 0.08
94 0.06
95 0.04
96 0.03
97 0.05
98 0.05
99 0.05
100 0.05
101 0.06
102 0.07
103 0.09
104 0.09
105 0.07
106 0.09
107 0.09
108 0.1
109 0.1
110 0.09
111 0.08
112 0.08
113 0.08
114 0.07
115 0.09
116 0.08
117 0.1
118 0.17
119 0.2
120 0.27
121 0.34
122 0.43
123 0.51
124 0.62
125 0.69
126 0.68
127 0.72
128 0.66
129 0.6
130 0.55
131 0.46
132 0.42
133 0.36
134 0.31
135 0.31
136 0.32
137 0.31
138 0.28
139 0.28
140 0.23
141 0.23
142 0.21
143 0.17
144 0.2
145 0.2
146 0.21
147 0.23
148 0.24
149 0.26
150 0.32
151 0.33
152 0.3
153 0.34
154 0.36
155 0.41
156 0.48
157 0.48
158 0.49
159 0.52
160 0.58
161 0.6
162 0.62
163 0.59
164 0.6
165 0.64
166 0.66
167 0.67
168 0.65
169 0.69
170 0.71
171 0.7
172 0.7
173 0.72
174 0.72
175 0.75
176 0.79
177 0.79
178 0.83
179 0.89
180 0.89
181 0.88
182 0.85
183 0.83
184 0.8
185 0.75
186 0.68
187 0.6
188 0.51
189 0.43
190 0.37
191 0.3
192 0.21
193 0.16
194 0.12
195 0.12
196 0.12
197 0.11
198 0.12
199 0.13
200 0.15
201 0.21
202 0.24
203 0.28
204 0.34
205 0.38
206 0.45
207 0.53
208 0.58
209 0.58
210 0.65
211 0.7
212 0.73
213 0.76
214 0.76
215 0.69
216 0.72