Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4T9U2

Protein Details
Accession A0A1E4T9U2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
63-84ASLLNKFKRDPRNKNNPIDAPWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 6
Family & Domain DBs
Amino Acid Sequences MKCVGRDKGVRWRRLKGVIIDYIRKEGSELAIEVGVAGAASAQSWYRVCSFERVRYKRCKTLASLLNKFKRDPRNKNNPIDAPWQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.66
3 0.61
4 0.58
5 0.57
6 0.56
7 0.54
8 0.48
9 0.44
10 0.39
11 0.32
12 0.27
13 0.2
14 0.17
15 0.13
16 0.12
17 0.09
18 0.09
19 0.09
20 0.08
21 0.07
22 0.05
23 0.03
24 0.03
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.04
31 0.04
32 0.06
33 0.07
34 0.09
35 0.1
36 0.17
37 0.21
38 0.29
39 0.39
40 0.44
41 0.5
42 0.59
43 0.65
44 0.66
45 0.66
46 0.61
47 0.56
48 0.59
49 0.6
50 0.59
51 0.61
52 0.63
53 0.66
54 0.64
55 0.62
56 0.6
57 0.63
58 0.65
59 0.67
60 0.68
61 0.72
62 0.8
63 0.86
64 0.88
65 0.82