Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H2AYX4

Protein Details
Accession H2AYX4   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
79-109STSGWRDARHHNYKRNKKLRKTKKKGSFTKFBasic
NLS Segment(s)
PositionSequence
89-105HNYKRNKKLRKTKKKGS
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG kaf:KAFR_0H01200  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRAKSHLKAKSVKRNAEFQKVVDERGKRISEKLQQDLINQKVKQLKEQDPTKDAMEIEEISNDNIEKEGEPVKVSTSGWRDARHHNYKRNKKLRKTKKKGSFTKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.73
3 0.76
4 0.69
5 0.73
6 0.73
7 0.74
8 0.65
9 0.55
10 0.56
11 0.48
12 0.48
13 0.44
14 0.4
15 0.33
16 0.38
17 0.4
18 0.31
19 0.33
20 0.37
21 0.39
22 0.43
23 0.44
24 0.42
25 0.41
26 0.42
27 0.46
28 0.44
29 0.43
30 0.37
31 0.37
32 0.37
33 0.36
34 0.39
35 0.39
36 0.4
37 0.41
38 0.46
39 0.45
40 0.42
41 0.43
42 0.38
43 0.33
44 0.26
45 0.19
46 0.15
47 0.12
48 0.1
49 0.1
50 0.1
51 0.08
52 0.09
53 0.08
54 0.06
55 0.06
56 0.06
57 0.05
58 0.07
59 0.1
60 0.1
61 0.11
62 0.11
63 0.12
64 0.13
65 0.13
66 0.17
67 0.18
68 0.24
69 0.27
70 0.31
71 0.33
72 0.41
73 0.5
74 0.55
75 0.6
76 0.63
77 0.71
78 0.79
79 0.86
80 0.88
81 0.88
82 0.88
83 0.92
84 0.94
85 0.94
86 0.94
87 0.93
88 0.93
89 0.94