Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TIL7

Protein Details
Accession A0A1E4TIL7   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
73-104LIDDAPKKKSNTRPQPARKTQRPMNRKRQLQRHydrophilic
NLS Segment(s)
PositionSequence
79-103KKKSNTRPQPARKTQRPMNRKRQLQ
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR034102  Sm_D1  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0005634  C:nucleus  
GO:1990904  C:ribonucleoprotein complex  
GO:0120114  C:Sm-like protein family complex  
GO:0000387  P:spliceosomal snRNP assembly  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01724  Sm_D1  
Amino Acid Sequences MKLNSETVQIELKNGTVISGTITSVSPSMNTTMKTVKMAIKDRDPVALDYINIRGNTIRYIILPDALPLDTLLIDDAPKKKSNTRPQPARKTQRPMNRKRQLQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.09
4 0.09
5 0.09
6 0.09
7 0.09
8 0.08
9 0.09
10 0.09
11 0.09
12 0.09
13 0.07
14 0.08
15 0.1
16 0.11
17 0.12
18 0.14
19 0.16
20 0.17
21 0.18
22 0.19
23 0.2
24 0.24
25 0.3
26 0.31
27 0.32
28 0.35
29 0.34
30 0.34
31 0.33
32 0.27
33 0.23
34 0.2
35 0.16
36 0.13
37 0.14
38 0.14
39 0.12
40 0.12
41 0.1
42 0.1
43 0.11
44 0.11
45 0.09
46 0.07
47 0.1
48 0.1
49 0.1
50 0.1
51 0.09
52 0.09
53 0.09
54 0.09
55 0.06
56 0.07
57 0.05
58 0.05
59 0.05
60 0.04
61 0.05
62 0.08
63 0.12
64 0.15
65 0.19
66 0.22
67 0.3
68 0.4
69 0.51
70 0.58
71 0.66
72 0.74
73 0.8
74 0.89
75 0.92
76 0.93
77 0.91
78 0.89
79 0.87
80 0.87
81 0.87
82 0.87
83 0.87
84 0.87