FuNGI

A0A1E4TDM5

Protein Details

Accession

A0A1E4TDM5

Localization Confidence

Medium

Confidence Score

10.2

NoLS Segment(s)

Position	Sequence	Protein Nature
88-118	AVFYLYKSAPRFRRRRKRRAQRAPNGARKEV	Hydrophilic

NLS Segment(s)

Position	Sequence
97-116	PRFRRRRKRRAQRAPNGARK

Subcellular Location(s)

cyto 10.5, cyto_nucl 9.5, nucl 7.5, mito 4, pero 3

Family & Domain DBs

InterPro	View protein in InterPro IPR013952 DUF1776_fun IPR036291 NAD(P)-bd_dom_sf
Gene Ontology	GO:0016020 C:membrane
Pfam	View protein in Pfam PF08643 DUF1776

Amino Acid Sequences

MSGDPLEYVLDKFYAVSIDVHDKLQYLIHEVPDILQTKRILEYFPWHRSSPDPIPDPPQIDVCVDTGASWLTRNRVYVIASAAIGLGAVFYLYKSAPRFRRRRKRRAQRAPNGARKEVVVIAGSPGEQIFKSVVNDLDKRGFIIYCVVSSAEEEAAVGREDSPDIRSLRLNSSDTTAIKSEFDRFSSFLDTPSLAFPGATPHKLCFAGLIILPSMYYPTGPLETLSIDAWTDVIYAKVLGCVALLSQGFCQLVRQHRSRIVILTPAVVPALQLPYHSMECVVSASLSSLALCLSRELRPLNVPVINIRLGAFDLSTAGPNYSHYYARHVLSAARSDVLTWSENARRVYGHTYTNAIRFSAPRVRNSGRSDAVDALDLTGSAIEKDDLVSLRGSSLKRLYWAIFDVLTDPEPPRIYYAGLGARSYDIIGSIVPERVMDMILRSRLAMD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.1
2	0.1
3	0.11
4	0.13
5	0.19
6	0.2
7	0.21
8	0.21
9	0.2
10	0.2
11	0.22
12	0.19
13	0.18
14	0.19
15	0.2
16	0.2
17	0.2
18	0.2
19	0.23
20	0.25
21	0.2
22	0.22
23	0.22
24	0.23
25	0.26
26	0.26
27	0.22
28	0.22
29	0.31
30	0.35
31	0.42
32	0.44
33	0.42
34	0.43
35	0.44
36	0.5
37	0.48
38	0.48
39	0.45
40	0.43
41	0.49
42	0.51
43	0.51
44	0.44
45	0.39
46	0.31
47	0.28
48	0.26
49	0.21
50	0.17
51	0.14
52	0.12
53	0.11
54	0.1
55	0.09
56	0.1
57	0.12
58	0.15
59	0.17
60	0.18
61	0.19
62	0.21
63	0.22
64	0.22
65	0.22
66	0.19
67	0.17
68	0.16
69	0.14
70	0.11
71	0.09
72	0.07
73	0.04
74	0.03
75	0.03
76	0.02
77	0.02
78	0.04
79	0.04
80	0.09
81	0.12
82	0.2
83	0.3
84	0.4
85	0.51
86	0.62
87	0.73
88	0.8
89	0.89
90	0.92
91	0.94
92	0.96
93	0.96
94	0.96
95	0.95
96	0.96
97	0.95
98	0.93
99	0.88
100	0.78
101	0.67
102	0.56
103	0.48
104	0.37
105	0.28
106	0.18
107	0.12
108	0.12
109	0.11
110	0.11
111	0.08
112	0.07
113	0.07
114	0.06
115	0.07
116	0.07
117	0.08
118	0.09
119	0.11
120	0.14
121	0.18
122	0.19
123	0.21
124	0.23
125	0.22
126	0.21
127	0.21
128	0.18
129	0.13
130	0.16
131	0.14
132	0.11
133	0.11
134	0.11
135	0.1
136	0.1
137	0.11
138	0.07
139	0.06
140	0.06
141	0.05
142	0.06
143	0.06
144	0.06
145	0.05
146	0.05
147	0.06
148	0.07
149	0.08
150	0.11
151	0.12
152	0.13
153	0.15
154	0.17
155	0.2
156	0.23
157	0.24
158	0.2
159	0.22
160	0.24
161	0.22
162	0.22
163	0.2
164	0.16
165	0.16
166	0.16
167	0.18
168	0.16
169	0.17
170	0.17
171	0.16
172	0.17
173	0.2
174	0.2
175	0.16
176	0.16
177	0.15
178	0.13
179	0.13
180	0.12
181	0.08
182	0.08
183	0.07
184	0.12
185	0.14
186	0.15
187	0.15
188	0.15
189	0.18
190	0.18
191	0.18
192	0.12
193	0.1
194	0.1
195	0.1
196	0.1
197	0.07
198	0.07
199	0.07
200	0.06
201	0.06
202	0.04
203	0.04
204	0.04
205	0.05
206	0.06
207	0.06
208	0.06
209	0.06
210	0.06
211	0.07
212	0.07
213	0.06
214	0.05
215	0.05
216	0.05
217	0.04
218	0.04
219	0.03
220	0.04
221	0.03
222	0.04
223	0.04
224	0.04
225	0.04
226	0.04
227	0.03
228	0.03
229	0.03
230	0.05
231	0.05
232	0.06
233	0.06
234	0.08
235	0.08
236	0.08
237	0.09
238	0.11
239	0.19
240	0.24
241	0.27
242	0.29
243	0.33
244	0.36
245	0.36
246	0.34
247	0.28
248	0.26
249	0.23
250	0.21
251	0.17
252	0.14
253	0.13
254	0.1
255	0.09
256	0.06
257	0.08
258	0.06
259	0.06
260	0.08
261	0.11
262	0.11
263	0.11
264	0.1
265	0.09
266	0.09
267	0.09
268	0.08
269	0.05
270	0.05
271	0.05
272	0.05
273	0.05
274	0.05
275	0.04
276	0.04
277	0.05
278	0.05
279	0.06
280	0.08
281	0.09
282	0.12
283	0.13
284	0.15
285	0.17
286	0.19
287	0.21
288	0.21
289	0.2
290	0.18
291	0.2
292	0.19
293	0.17
294	0.15
295	0.12
296	0.11
297	0.11
298	0.09
299	0.06
300	0.07
301	0.07
302	0.07
303	0.07
304	0.08
305	0.07
306	0.09
307	0.13
308	0.14
309	0.16
310	0.16
311	0.22
312	0.25
313	0.26
314	0.26
315	0.23
316	0.23
317	0.23
318	0.26
319	0.21
320	0.18
321	0.16
322	0.15
323	0.16
324	0.16
325	0.14
326	0.12
327	0.15
328	0.19
329	0.24
330	0.24
331	0.24
332	0.22
333	0.24
334	0.29
335	0.28
336	0.27
337	0.24
338	0.27
339	0.29
340	0.32
341	0.3
342	0.26
343	0.24
344	0.21
345	0.26
346	0.31
347	0.32
348	0.32
349	0.4
350	0.43
351	0.49
352	0.54
353	0.55
354	0.49
355	0.48
356	0.47
357	0.41
358	0.38
359	0.31
360	0.26
361	0.19
362	0.15
363	0.12
364	0.09
365	0.08
366	0.07
367	0.06
368	0.06
369	0.06
370	0.06
371	0.07
372	0.09
373	0.09
374	0.11
375	0.11
376	0.11
377	0.12
378	0.17
379	0.17
380	0.2
381	0.23
382	0.23
383	0.26
384	0.29
385	0.29
386	0.27
387	0.29
388	0.26
389	0.22
390	0.21
391	0.2
392	0.18
393	0.18
394	0.17
395	0.16
396	0.18
397	0.19
398	0.19
399	0.21
400	0.2
401	0.2
402	0.19
403	0.24
404	0.25
405	0.25
406	0.25
407	0.23
408	0.23
409	0.22
410	0.21
411	0.15
412	0.1
413	0.09
414	0.08
415	0.1
416	0.11
417	0.12
418	0.11
419	0.11
420	0.11
421	0.11
422	0.12
423	0.1
424	0.12
425	0.17
426	0.2
427	0.2

A0A1E4TDM5

3D AlphaFold-predicted Structure Viewer