Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4TJG6

Protein Details
Accession A0A1E4TJG6    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
49-71LRSRTGKKILARRKLKGRWRLTHBasic
NLS Segment(s)
PositionSequence
38-69RRKRKFGFLARLRSRTGKKILARRKLKGRWRL
Subcellular Location(s) mito 21.5, mito_nucl 12.833, nucl 3, cyto_nucl 2.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MHNQRHQPSMLQLIMSQPSTFQRRLKSRGNTYQPSTLRRKRKFGFLARLRSRTGKKILARRKLKGRWRLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.19
4 0.14
5 0.18
6 0.22
7 0.25
8 0.26
9 0.32
10 0.39
11 0.45
12 0.53
13 0.56
14 0.6
15 0.66
16 0.7
17 0.66
18 0.63
19 0.65
20 0.58
21 0.56
22 0.56
23 0.54
24 0.57
25 0.57
26 0.62
27 0.56
28 0.63
29 0.66
30 0.66
31 0.69
32 0.66
33 0.72
34 0.7
35 0.72
36 0.65
37 0.63
38 0.59
39 0.55
40 0.53
41 0.5
42 0.51
43 0.58
44 0.66
45 0.69
46 0.73
47 0.75
48 0.79
49 0.81
50 0.83
51 0.83