Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TH12

Protein Details
Accession A0A1E4TH12    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
148-173LYKRMEAKAKKQKKGIWSKSRFETPAHydrophilic
NLS Segment(s)
PositionSequence
150-168KRMEAKAKKQKKGIWSKSR
Subcellular Location(s) mito 10, cyto 9, cyto_nucl 8, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035437  SNase_OB-fold_sf  
IPR016071  Staphylococal_nuclease_OB-fold  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF00565  SNase  
PROSITE View protein in PROSITE  
PS50830  TNASE_3  
Amino Acid Sequences KLFGKIVAVNDGDNVRVFHTPGGYWAGWGWLRSTPRVKGEPRVTNRSIHVRLCGIDAPEASHFGQPGQWGAQQAIQELRRLALGRRCYIQVYSIDQYGRAVGRVKVCGPMRLIGKPSSFYDLSAQMLRSGWALIYEGKDIEYANRKELYKRMEAKAKKQKKGIWSKSRFETPAAYKSKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.14
4 0.14
5 0.13
6 0.14
7 0.13
8 0.14
9 0.19
10 0.17
11 0.16
12 0.16
13 0.18
14 0.18
15 0.18
16 0.17
17 0.17
18 0.19
19 0.24
20 0.29
21 0.3
22 0.35
23 0.42
24 0.43
25 0.48
26 0.55
27 0.59
28 0.61
29 0.65
30 0.61
31 0.57
32 0.58
33 0.57
34 0.52
35 0.44
36 0.39
37 0.32
38 0.31
39 0.3
40 0.28
41 0.2
42 0.17
43 0.15
44 0.15
45 0.14
46 0.15
47 0.14
48 0.13
49 0.12
50 0.1
51 0.11
52 0.1
53 0.11
54 0.1
55 0.1
56 0.1
57 0.11
58 0.13
59 0.12
60 0.13
61 0.16
62 0.15
63 0.15
64 0.14
65 0.14
66 0.13
67 0.13
68 0.15
69 0.16
70 0.19
71 0.19
72 0.2
73 0.21
74 0.21
75 0.2
76 0.2
77 0.16
78 0.17
79 0.17
80 0.17
81 0.16
82 0.15
83 0.15
84 0.14
85 0.12
86 0.09
87 0.1
88 0.1
89 0.12
90 0.14
91 0.15
92 0.2
93 0.21
94 0.22
95 0.21
96 0.23
97 0.23
98 0.24
99 0.26
100 0.23
101 0.23
102 0.23
103 0.23
104 0.24
105 0.21
106 0.2
107 0.2
108 0.19
109 0.2
110 0.19
111 0.18
112 0.14
113 0.14
114 0.13
115 0.11
116 0.1
117 0.08
118 0.06
119 0.07
120 0.08
121 0.09
122 0.1
123 0.1
124 0.1
125 0.1
126 0.1
127 0.14
128 0.21
129 0.21
130 0.25
131 0.29
132 0.3
133 0.33
134 0.38
135 0.39
136 0.39
137 0.45
138 0.48
139 0.53
140 0.58
141 0.65
142 0.71
143 0.75
144 0.74
145 0.75
146 0.74
147 0.75
148 0.8
149 0.81
150 0.81
151 0.79
152 0.79
153 0.79
154 0.81
155 0.72
156 0.64
157 0.61
158 0.56
159 0.57