Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TAJ9

Protein Details
Accession A0A1E4TAJ9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
114-133DRFKVSLLKKQRRSAVQKAIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 24, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR014722  Rib_L2_dom2  
IPR002784  Ribosomal_L14e_dom  
IPR039660  Ribosomal_protein_L14  
IPR041985  RPL14_KOW  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01929  Ribosomal_L14e  
CDD cd06088  KOW_RPL14  
Amino Acid Sequences MTEITSPNWKLVEVGRVIFIERGADAGKLAVIVDIIDHKRVLIDGPTTGVLRSSLNLRYAILTPFVVEKLPRSAGSPTVAKYYKLSDIDSKWAASPMAKKLASRATRSKLNDFDRFKVSLLKKQRRSAVQKAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.21
4 0.22
5 0.21
6 0.18
7 0.12
8 0.1
9 0.1
10 0.09
11 0.09
12 0.08
13 0.07
14 0.07
15 0.06
16 0.06
17 0.05
18 0.04
19 0.04
20 0.04
21 0.08
22 0.09
23 0.1
24 0.1
25 0.1
26 0.1
27 0.11
28 0.11
29 0.09
30 0.09
31 0.08
32 0.1
33 0.11
34 0.11
35 0.11
36 0.1
37 0.09
38 0.08
39 0.08
40 0.1
41 0.1
42 0.12
43 0.12
44 0.12
45 0.13
46 0.14
47 0.14
48 0.12
49 0.1
50 0.09
51 0.09
52 0.09
53 0.07
54 0.07
55 0.07
56 0.09
57 0.1
58 0.1
59 0.11
60 0.12
61 0.14
62 0.16
63 0.17
64 0.15
65 0.2
66 0.2
67 0.19
68 0.19
69 0.2
70 0.22
71 0.22
72 0.23
73 0.22
74 0.23
75 0.27
76 0.27
77 0.26
78 0.21
79 0.21
80 0.19
81 0.17
82 0.19
83 0.19
84 0.25
85 0.25
86 0.25
87 0.28
88 0.37
89 0.4
90 0.42
91 0.46
92 0.44
93 0.51
94 0.56
95 0.59
96 0.58
97 0.61
98 0.64
99 0.61
100 0.59
101 0.55
102 0.52
103 0.46
104 0.47
105 0.44
106 0.43
107 0.5
108 0.56
109 0.6
110 0.67
111 0.74
112 0.75
113 0.79