Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4TEU7

Protein Details
Accession A0A1E4TEU7    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
88-117IEEEKARKREDRRIRRRQERAAKRYNEDSEBasic
NLS Segment(s)
PositionSequence
92-111KARKREDRRIRRRQERAAKR
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR040107  Snu23  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0046872  F:metal ion binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Amino Acid Sequences MSLNLLGDRPGYHCSACRVTYHDSLRWIDHCNSRSHLKAIGQEHVLAYDRTATLEEVRKRIHELAEMQKPKNESYDLRKNIATKEEAIEEEKARKREDRRIRRRQERAAKRYNEDSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.28
4 0.28
5 0.29
6 0.33
7 0.39
8 0.42
9 0.39
10 0.38
11 0.39
12 0.4
13 0.37
14 0.37
15 0.33
16 0.36
17 0.35
18 0.34
19 0.36
20 0.37
21 0.37
22 0.34
23 0.33
24 0.29
25 0.32
26 0.31
27 0.31
28 0.28
29 0.26
30 0.24
31 0.21
32 0.2
33 0.13
34 0.11
35 0.09
36 0.08
37 0.08
38 0.08
39 0.08
40 0.09
41 0.16
42 0.18
43 0.2
44 0.2
45 0.2
46 0.22
47 0.23
48 0.21
49 0.17
50 0.2
51 0.24
52 0.32
53 0.35
54 0.33
55 0.34
56 0.35
57 0.33
58 0.31
59 0.26
60 0.21
61 0.26
62 0.36
63 0.37
64 0.39
65 0.4
66 0.39
67 0.39
68 0.39
69 0.33
70 0.24
71 0.23
72 0.22
73 0.21
74 0.22
75 0.22
76 0.2
77 0.26
78 0.3
79 0.31
80 0.32
81 0.38
82 0.41
83 0.5
84 0.59
85 0.62
86 0.68
87 0.77
88 0.85
89 0.89
90 0.92
91 0.93
92 0.93
93 0.92
94 0.91
95 0.91
96 0.87
97 0.82