Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TDB3

Protein Details
Accession A0A1E4TDB3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
95-124MEKRSVARKKKAAKPSKPKKTKQFNVSWTMHydrophilic
NLS Segment(s)
PositionSequence
97-116KRSVARKKKAAKPSKPKKTK
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036788  T_IF-3_C_sf  
Gene Ontology GO:0006413  P:translational initiation  
Amino Acid Sequences MMRIRSGMACFNLIACTRAVPVARFSCMRTVYIRQAVPEALQGLRSNKVTLIDIEGKKLGAVAVEDTHQYYDPEIHELTVVKVGEAGQSPVVRVMEKRSVARKKKAAKPSKPKKTKQFNVSWTMAPADHKNRIKNAIQQLQKGHPVEFRFGFTGLTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.14
3 0.13
4 0.12
5 0.15
6 0.16
7 0.14
8 0.2
9 0.22
10 0.24
11 0.25
12 0.26
13 0.29
14 0.29
15 0.29
16 0.27
17 0.3
18 0.34
19 0.39
20 0.38
21 0.32
22 0.33
23 0.31
24 0.27
25 0.24
26 0.19
27 0.12
28 0.13
29 0.14
30 0.15
31 0.17
32 0.17
33 0.16
34 0.15
35 0.17
36 0.16
37 0.14
38 0.17
39 0.22
40 0.22
41 0.23
42 0.22
43 0.21
44 0.19
45 0.19
46 0.14
47 0.06
48 0.06
49 0.05
50 0.06
51 0.06
52 0.07
53 0.07
54 0.08
55 0.08
56 0.07
57 0.07
58 0.08
59 0.08
60 0.1
61 0.09
62 0.09
63 0.09
64 0.09
65 0.09
66 0.1
67 0.1
68 0.07
69 0.07
70 0.07
71 0.08
72 0.08
73 0.08
74 0.07
75 0.08
76 0.08
77 0.09
78 0.09
79 0.09
80 0.09
81 0.13
82 0.16
83 0.19
84 0.22
85 0.3
86 0.4
87 0.47
88 0.55
89 0.59
90 0.62
91 0.69
92 0.77
93 0.78
94 0.79
95 0.83
96 0.86
97 0.89
98 0.9
99 0.9
100 0.9
101 0.9
102 0.89
103 0.87
104 0.85
105 0.8
106 0.78
107 0.72
108 0.62
109 0.52
110 0.45
111 0.36
112 0.3
113 0.29
114 0.28
115 0.34
116 0.38
117 0.42
118 0.45
119 0.5
120 0.51
121 0.53
122 0.57
123 0.57
124 0.57
125 0.58
126 0.59
127 0.58
128 0.61
129 0.54
130 0.46
131 0.42
132 0.4
133 0.41
134 0.37
135 0.35
136 0.3
137 0.29