Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4TAG0

Protein Details
Accession A0A1E4TAG0    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
59-84QDPEKMARKEWRAKNRKNIRTANFLKHydrophilic
NLS Segment(s)
PositionSequence
66-75RKEWRAKNRK
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLKLQRIVRYNSTIVQGTVMKGINLKKNGADPIAKPDNEYPDWLWTLLDPEAQKQRLAQDPEKMARKEWRAKNRKNIRTANFLKSMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.23
4 0.19
5 0.2
6 0.17
7 0.14
8 0.16
9 0.2
10 0.24
11 0.25
12 0.25
13 0.23
14 0.26
15 0.28
16 0.27
17 0.25
18 0.19
19 0.25
20 0.3
21 0.28
22 0.27
23 0.27
24 0.3
25 0.28
26 0.29
27 0.22
28 0.18
29 0.19
30 0.18
31 0.15
32 0.1
33 0.11
34 0.1
35 0.11
36 0.09
37 0.12
38 0.17
39 0.18
40 0.18
41 0.18
42 0.21
43 0.26
44 0.32
45 0.32
46 0.33
47 0.38
48 0.44
49 0.5
50 0.47
51 0.44
52 0.45
53 0.5
54 0.54
55 0.58
56 0.63
57 0.66
58 0.75
59 0.82
60 0.85
61 0.86
62 0.86
63 0.86
64 0.81
65 0.81
66 0.78
67 0.74