Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TCQ9

Protein Details
Accession A0A1E4TCQ9    Localization Confidence High Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-34LLRRELKTWEKDFKKKHGRKPNKNDIKSDKAIBasic
212-242QKETSPTKPTFQKKIKRNRPVHRLKIVPEKMHydrophilic
NLS Segment(s)
PositionSequence
14-25DFKKKHGRKPNK
224-261KKIKRNRPVHRLKIVPEKMSKPSANYRRLNIRGKFGKR
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021110  DNA_rep_checkpnt_protein  
IPR040203  Sld2  
Gene Ontology GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0006270  P:DNA replication initiation  
Pfam View protein in Pfam  
PF11719  Drc1-Sld2  
CDD cd22289  RecQL4_SLD2_NTD  
Amino Acid Sequences MDLLRRELKTWEKDFKKKHGRKPNKNDIKSDKAIASLYKSYNDMKREPKNDIFNETPTKLIGQVVGPTPDLKGRVLSIFDIKSPPNCNDSNLDSDIASSTPCGANITTPVKSRHISNMDETPLYLKFPIGSSPSPLKPRSTGSLKALLERAQSVREMPSLSPDRSDVTQPNSFDLSANSGSPFAFSQPLFSLGSIANASDLPHSPPAPTTTQKETSPTKPTFQKKIKRNRPVHRLKIVPEKMSKPSANYRRLNIRGKFGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.78
3 0.81
4 0.81
5 0.85
6 0.86
7 0.88
8 0.9
9 0.93
10 0.94
11 0.94
12 0.9
13 0.89
14 0.86
15 0.84
16 0.76
17 0.69
18 0.59
19 0.49
20 0.45
21 0.37
22 0.34
23 0.3
24 0.27
25 0.25
26 0.27
27 0.3
28 0.34
29 0.37
30 0.38
31 0.42
32 0.5
33 0.52
34 0.57
35 0.59
36 0.62
37 0.6
38 0.61
39 0.55
40 0.51
41 0.53
42 0.46
43 0.4
44 0.31
45 0.29
46 0.23
47 0.2
48 0.16
49 0.1
50 0.12
51 0.14
52 0.14
53 0.14
54 0.14
55 0.14
56 0.15
57 0.15
58 0.13
59 0.12
60 0.12
61 0.13
62 0.14
63 0.15
64 0.17
65 0.16
66 0.17
67 0.18
68 0.18
69 0.2
70 0.22
71 0.23
72 0.23
73 0.23
74 0.24
75 0.25
76 0.27
77 0.28
78 0.26
79 0.24
80 0.19
81 0.19
82 0.18
83 0.14
84 0.11
85 0.07
86 0.06
87 0.06
88 0.06
89 0.07
90 0.06
91 0.07
92 0.11
93 0.14
94 0.15
95 0.18
96 0.2
97 0.23
98 0.23
99 0.24
100 0.27
101 0.28
102 0.28
103 0.28
104 0.29
105 0.27
106 0.27
107 0.25
108 0.19
109 0.15
110 0.14
111 0.11
112 0.07
113 0.06
114 0.07
115 0.09
116 0.1
117 0.1
118 0.13
119 0.17
120 0.2
121 0.24
122 0.25
123 0.25
124 0.23
125 0.26
126 0.28
127 0.29
128 0.29
129 0.28
130 0.35
131 0.33
132 0.33
133 0.32
134 0.27
135 0.23
136 0.21
137 0.19
138 0.12
139 0.12
140 0.12
141 0.11
142 0.11
143 0.12
144 0.1
145 0.17
146 0.2
147 0.2
148 0.2
149 0.19
150 0.2
151 0.2
152 0.23
153 0.19
154 0.21
155 0.25
156 0.24
157 0.25
158 0.25
159 0.24
160 0.21
161 0.19
162 0.17
163 0.14
164 0.14
165 0.12
166 0.11
167 0.11
168 0.12
169 0.11
170 0.08
171 0.11
172 0.1
173 0.12
174 0.12
175 0.15
176 0.15
177 0.15
178 0.15
179 0.12
180 0.14
181 0.12
182 0.1
183 0.09
184 0.08
185 0.09
186 0.09
187 0.1
188 0.11
189 0.14
190 0.14
191 0.14
192 0.16
193 0.19
194 0.22
195 0.26
196 0.28
197 0.32
198 0.36
199 0.37
200 0.41
201 0.43
202 0.45
203 0.49
204 0.47
205 0.47
206 0.51
207 0.58
208 0.63
209 0.67
210 0.71
211 0.72
212 0.8
213 0.84
214 0.86
215 0.89
216 0.89
217 0.9
218 0.91
219 0.92
220 0.89
221 0.84
222 0.8
223 0.81
224 0.77
225 0.73
226 0.68
227 0.63
228 0.6
229 0.62
230 0.57
231 0.52
232 0.56
233 0.59
234 0.62
235 0.62
236 0.63
237 0.66
238 0.72
239 0.76
240 0.7
241 0.71