Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TFR3

Protein Details
Accession A0A1E4TFR3   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
96-130QATAPERASRQQRKQRKNRDKKTRGTGKKPNKREKBasic
NLS Segment(s)
PositionSequence
102-130RASRQQRKQRKNRDKKTRGTGKKPNKREK
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSDSVTIRTRKFIRNPLLARRQMVVDVLHPNLANVSKDDLRARLAEMYGSEKDVISVFGLRTQFGGGKSTGFALIYDSAEAFTKFEPLYRRIRVGQATAPERASRQQRKQRKNRDKKTRGTGKKPNKREK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.7
3 0.72
4 0.77
5 0.72
6 0.66
7 0.58
8 0.5
9 0.41
10 0.37
11 0.28
12 0.21
13 0.2
14 0.19
15 0.19
16 0.17
17 0.17
18 0.16
19 0.17
20 0.14
21 0.11
22 0.15
23 0.14
24 0.17
25 0.19
26 0.18
27 0.18
28 0.18
29 0.18
30 0.15
31 0.14
32 0.12
33 0.12
34 0.14
35 0.13
36 0.13
37 0.12
38 0.11
39 0.11
40 0.1
41 0.1
42 0.06
43 0.07
44 0.06
45 0.09
46 0.09
47 0.09
48 0.09
49 0.09
50 0.1
51 0.1
52 0.12
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.07
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.06
65 0.07
66 0.07
67 0.07
68 0.07
69 0.06
70 0.08
71 0.08
72 0.11
73 0.14
74 0.18
75 0.25
76 0.27
77 0.31
78 0.31
79 0.36
80 0.35
81 0.35
82 0.35
83 0.34
84 0.35
85 0.33
86 0.33
87 0.29
88 0.28
89 0.31
90 0.38
91 0.4
92 0.48
93 0.56
94 0.66
95 0.76
96 0.85
97 0.91
98 0.92
99 0.93
100 0.94
101 0.95
102 0.94
103 0.93
104 0.93
105 0.93
106 0.92
107 0.91
108 0.91
109 0.91
110 0.92