Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TG43

Protein Details
Accession A0A1E4TG43    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-51NIPKTRRTFCPGKQCRKHTQHRVTQYKAGKASPRPQGARRYKRKQSGYGHydrophilic
NLS Segment(s)
PositionSequence
31-64GKASPRPQGARRYKRKQSGYGGQTKPVFHKKAKT
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTFCPGKQCRKHTQHRVTQYKAGKASPRPQGARRYKRKQSGYGGQTKPVFHKKAKTTKKIVLRLECTSCKYKLQLCLKRCKHFELGGDKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.79
3 0.81
4 0.84
5 0.85
6 0.88
7 0.87
8 0.87
9 0.85
10 0.86
11 0.87
12 0.81
13 0.8
14 0.74
15 0.69
16 0.62
17 0.56
18 0.51
19 0.48
20 0.51
21 0.51
22 0.52
23 0.5
24 0.53
25 0.6
26 0.65
27 0.69
28 0.72
29 0.74
30 0.75
31 0.8
32 0.8
33 0.76
34 0.73
35 0.71
36 0.67
37 0.68
38 0.6
39 0.55
40 0.51
41 0.45
42 0.42
43 0.4
44 0.38
45 0.3
46 0.37
47 0.41
48 0.5
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.63
58 0.6
59 0.59
60 0.54
61 0.49
62 0.45
63 0.4
64 0.35
65 0.34
66 0.34
67 0.38
68 0.46
69 0.5
70 0.53
71 0.63
72 0.69
73 0.74
74 0.72
75 0.69
76 0.64
77 0.6
78 0.61
79 0.6
80 0.61
81 0.62
82 0.67
83 0.62
84 0.61
85 0.61
86 0.57