Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TIM4

Protein Details
Accession A0A1E4TIM4   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-22VETIQYPKKKQNKVVRYDSIAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.5, nucl 12, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR024747  Pyridox_Oxase-rel  
IPR012349  Split_barrel_FMN-bd  
Pfam View protein in Pfam  
PF12900  Pyridox_ox_2  
Amino Acid Sequences MVETIQYPKKKQNKVVRYDSIADYECKTVHSIVNESPVLHVSFVVDGLPVNLPMIGQMGSFDHPSAGLDEPLDLYIHGYVSARMMNTAGTEGMKVCVCASIVDGYILTYTPYSHNYNYRSSVIHGTATLVTDPDEKLYAMTIITDKIVPGRYENSRTPPTKGELAATSILKITVDSASAKVRAGYGVESAEDIIDENKKIWTGVMPISHIFEPPVPSAYNEVPLPSYISDFIEARNKESEEYIKYSTTVAPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.82
4 0.78
5 0.74
6 0.66
7 0.59
8 0.51
9 0.44
10 0.36
11 0.31
12 0.25
13 0.21
14 0.21
15 0.18
16 0.19
17 0.21
18 0.22
19 0.22
20 0.28
21 0.27
22 0.25
23 0.24
24 0.23
25 0.21
26 0.17
27 0.15
28 0.1
29 0.09
30 0.09
31 0.08
32 0.06
33 0.05
34 0.07
35 0.07
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.07
42 0.06
43 0.05
44 0.06
45 0.07
46 0.08
47 0.09
48 0.09
49 0.08
50 0.08
51 0.08
52 0.1
53 0.1
54 0.09
55 0.08
56 0.08
57 0.09
58 0.09
59 0.09
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.08
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.06
77 0.06
78 0.06
79 0.07
80 0.07
81 0.07
82 0.06
83 0.07
84 0.07
85 0.06
86 0.07
87 0.07
88 0.07
89 0.07
90 0.07
91 0.06
92 0.06
93 0.06
94 0.05
95 0.04
96 0.05
97 0.06
98 0.1
99 0.12
100 0.14
101 0.19
102 0.22
103 0.24
104 0.26
105 0.26
106 0.24
107 0.23
108 0.24
109 0.2
110 0.17
111 0.14
112 0.13
113 0.12
114 0.11
115 0.09
116 0.06
117 0.06
118 0.07
119 0.07
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.06
126 0.05
127 0.05
128 0.05
129 0.05
130 0.06
131 0.06
132 0.05
133 0.07
134 0.09
135 0.09
136 0.1
137 0.14
138 0.17
139 0.22
140 0.25
141 0.29
142 0.34
143 0.35
144 0.37
145 0.36
146 0.36
147 0.34
148 0.32
149 0.28
150 0.22
151 0.22
152 0.22
153 0.19
154 0.16
155 0.13
156 0.13
157 0.1
158 0.09
159 0.08
160 0.06
161 0.07
162 0.07
163 0.09
164 0.11
165 0.12
166 0.12
167 0.11
168 0.11
169 0.11
170 0.11
171 0.1
172 0.09
173 0.09
174 0.09
175 0.09
176 0.08
177 0.08
178 0.07
179 0.06
180 0.07
181 0.08
182 0.08
183 0.09
184 0.09
185 0.1
186 0.1
187 0.1
188 0.1
189 0.12
190 0.16
191 0.17
192 0.19
193 0.19
194 0.22
195 0.22
196 0.2
197 0.18
198 0.17
199 0.18
200 0.17
201 0.19
202 0.16
203 0.17
204 0.21
205 0.21
206 0.23
207 0.2
208 0.19
209 0.18
210 0.18
211 0.19
212 0.15
213 0.16
214 0.13
215 0.15
216 0.16
217 0.15
218 0.18
219 0.24
220 0.24
221 0.26
222 0.29
223 0.29
224 0.28
225 0.31
226 0.34
227 0.3
228 0.35
229 0.35
230 0.31
231 0.3
232 0.31