Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TL23

Protein Details
Accession A0A1E4TL23   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
94-120LTDFEKSRKTEKQRKKDVNFPQRKYAIHydrophilic
NLS Segment(s)
PositionSequence
72-110KVKKNRVPLDLRAKKTRALRRALTDFEKSRKTEKQRKKD
Subcellular Location(s) nucl 19, cyto_nucl 12.333, mito_nucl 11.833, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MVKAFELRTKSVEELQAQLVELKGDLQKYRMQKASNTGSRLAQIGVIRKDIARVLTVINQQQRAKAREQYSKVKKNRVPLDLRAKKTRALRRALTDFEKSRKTEKQRKKDVNFPQRKYAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.28
4 0.24
5 0.22
6 0.18
7 0.13
8 0.11
9 0.11
10 0.1
11 0.12
12 0.12
13 0.14
14 0.19
15 0.23
16 0.3
17 0.32
18 0.32
19 0.33
20 0.4
21 0.47
22 0.48
23 0.46
24 0.41
25 0.37
26 0.36
27 0.34
28 0.26
29 0.19
30 0.16
31 0.18
32 0.18
33 0.18
34 0.17
35 0.17
36 0.17
37 0.16
38 0.14
39 0.09
40 0.09
41 0.09
42 0.12
43 0.15
44 0.18
45 0.19
46 0.23
47 0.23
48 0.26
49 0.29
50 0.28
51 0.29
52 0.32
53 0.35
54 0.38
55 0.43
56 0.5
57 0.55
58 0.62
59 0.64
60 0.67
61 0.65
62 0.67
63 0.69
64 0.66
65 0.61
66 0.6
67 0.66
68 0.65
69 0.68
70 0.65
71 0.6
72 0.57
73 0.61
74 0.62
75 0.57
76 0.56
77 0.56
78 0.57
79 0.61
80 0.61
81 0.56
82 0.55
83 0.52
84 0.51
85 0.52
86 0.47
87 0.48
88 0.52
89 0.58
90 0.61
91 0.67
92 0.72
93 0.78
94 0.86
95 0.87
96 0.88
97 0.88
98 0.89
99 0.89
100 0.83
101 0.82
102 0.78