Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TF02

Protein Details
Accession A0A1E4TF02    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MSKSKNHTNHNQSRKNHRNGIKKPKTHRYPSHydrophilic
NLS Segment(s)
PositionSequence
14-52RKNHRNGIKKPKTHRYPSLKGVDPKFRRNHRHALHGTAR
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSKSKNHTNHNQSRKNHRNGIKKPKTHRYPSLKGVDPKFRRNHRHALHGTARALKEER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.81
4 0.79
5 0.79
6 0.8
7 0.85
8 0.83
9 0.81
10 0.81
11 0.82
12 0.82
13 0.78
14 0.78
15 0.76
16 0.72
17 0.71
18 0.7
19 0.65
20 0.62
21 0.6
22 0.61
23 0.56
24 0.59
25 0.6
26 0.63
27 0.66
28 0.66
29 0.72
30 0.66
31 0.72
32 0.67
33 0.67
34 0.65
35 0.62
36 0.59
37 0.55
38 0.51