Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TIL8

Protein Details
Accession A0A1E4TIL8    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
82-102YAKNHKEKQRRLKSVSQKLRAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR010684  RNA_pol_II_trans_fac_SIII_A  
Gene Ontology GO:0070449  C:elongin complex  
GO:0006368  P:transcription elongation by RNA polymerase II  
Pfam View protein in Pfam  
PF06881  Elongin_A  
Amino Acid Sequences MHPLKHLALQKCLRYINYITDVGEAPYELMEPILCKMSAPGLEAIEKASPQLRDRTDPLWKALLVRDFPTKDIPSTNFRSAYAKNHKEKQRRLKSVSQKLRASTESLNEQKSMMKITPLDDIPLSIKRAELARKLSNTPKKNLSIMQKARMEVRDNLRSRSKVHKPIRVTASSVIASQNNSHDQSSHNQTRSSTIPSVFSKPRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.41
4 0.39
5 0.36
6 0.31
7 0.3
8 0.29
9 0.24
10 0.22
11 0.15
12 0.1
13 0.09
14 0.08
15 0.06
16 0.06
17 0.06
18 0.06
19 0.07
20 0.09
21 0.09
22 0.08
23 0.09
24 0.12
25 0.13
26 0.14
27 0.15
28 0.14
29 0.15
30 0.15
31 0.16
32 0.13
33 0.12
34 0.11
35 0.13
36 0.14
37 0.16
38 0.23
39 0.24
40 0.27
41 0.31
42 0.34
43 0.38
44 0.38
45 0.39
46 0.34
47 0.32
48 0.29
49 0.29
50 0.29
51 0.23
52 0.23
53 0.27
54 0.25
55 0.26
56 0.29
57 0.27
58 0.23
59 0.25
60 0.26
61 0.26
62 0.31
63 0.33
64 0.29
65 0.29
66 0.32
67 0.3
68 0.37
69 0.41
70 0.43
71 0.45
72 0.53
73 0.61
74 0.66
75 0.74
76 0.76
77 0.76
78 0.76
79 0.76
80 0.77
81 0.79
82 0.81
83 0.8
84 0.77
85 0.68
86 0.62
87 0.59
88 0.5
89 0.43
90 0.33
91 0.26
92 0.25
93 0.25
94 0.24
95 0.21
96 0.21
97 0.19
98 0.18
99 0.18
100 0.12
101 0.11
102 0.11
103 0.12
104 0.14
105 0.13
106 0.14
107 0.12
108 0.12
109 0.13
110 0.14
111 0.14
112 0.11
113 0.11
114 0.11
115 0.15
116 0.17
117 0.2
118 0.24
119 0.27
120 0.3
121 0.34
122 0.42
123 0.49
124 0.5
125 0.5
126 0.5
127 0.48
128 0.48
129 0.5
130 0.49
131 0.5
132 0.51
133 0.53
134 0.5
135 0.48
136 0.5
137 0.47
138 0.43
139 0.39
140 0.42
141 0.43
142 0.43
143 0.47
144 0.49
145 0.48
146 0.48
147 0.52
148 0.54
149 0.55
150 0.61
151 0.65
152 0.63
153 0.7
154 0.73
155 0.65
156 0.59
157 0.51
158 0.47
159 0.4
160 0.35
161 0.29
162 0.23
163 0.22
164 0.21
165 0.22
166 0.23
167 0.24
168 0.24
169 0.22
170 0.23
171 0.29
172 0.37
173 0.41
174 0.4
175 0.4
176 0.4
177 0.44
178 0.45
179 0.44
180 0.38
181 0.31
182 0.34
183 0.36
184 0.43