Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4TLS1

Protein Details
Accession A0A1E4TLS1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
103-127HIHFANKALKDKKRKLDKKNKKRRHBasic
NLS Segment(s)
PositionSequence
109-127KALKDKKRKLDKKNKKRRH
Subcellular Location(s) cyto 15.5, cyto_nucl 11.333, cyto_mito 11.166, mito 5.5, nucl 5
Family & Domain DBs
Amino Acid Sequences MSSLLYLFGLSWRKSNELSKQETCDSRIIEQPVAEEIGVIGETDPVRVTITADEGFDIINLESVVLTSKMATVGAGAGAAAAAVATASSTNYDAECSDIDPIHIHFANKALKDKKRKLDKKNKKRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.36
3 0.41
4 0.42
5 0.49
6 0.49
7 0.52
8 0.54
9 0.53
10 0.5
11 0.45
12 0.39
13 0.34
14 0.35
15 0.33
16 0.29
17 0.26
18 0.24
19 0.21
20 0.19
21 0.16
22 0.11
23 0.08
24 0.07
25 0.06
26 0.05
27 0.04
28 0.05
29 0.05
30 0.06
31 0.06
32 0.06
33 0.07
34 0.07
35 0.07
36 0.06
37 0.09
38 0.09
39 0.09
40 0.08
41 0.08
42 0.08
43 0.07
44 0.07
45 0.04
46 0.04
47 0.04
48 0.04
49 0.03
50 0.04
51 0.04
52 0.04
53 0.04
54 0.03
55 0.04
56 0.04
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.02
65 0.02
66 0.02
67 0.02
68 0.01
69 0.01
70 0.01
71 0.01
72 0.02
73 0.02
74 0.02
75 0.03
76 0.04
77 0.05
78 0.05
79 0.06
80 0.07
81 0.08
82 0.08
83 0.08
84 0.1
85 0.09
86 0.1
87 0.1
88 0.11
89 0.15
90 0.16
91 0.15
92 0.14
93 0.2
94 0.25
95 0.27
96 0.35
97 0.38
98 0.45
99 0.56
100 0.65
101 0.7
102 0.75
103 0.82
104 0.85
105 0.89
106 0.92
107 0.92